KEGG   Glycine max (soybean): 100795626Help
Entry
100795626         CDS       T01710                                 

Definition
arginine--tRNA ligase, cytoplasmic-like
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
gmx  Glycine max (soybean)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:gmx00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 651 aa AA seqDB search
MLGLGCLNLNRFSHFPSTPSLPSSRSDLLKVASHRFALSATKTQQSSVTKPQSTSTAIIE
IDNPASVKRQLAQLFDLSLRETVPDEPHVVPLVDACAVKGGAKFGDYQCNNAMGIWSRMK
GKQTGFRGPPAIGQAIINNLPPSEMIDSCSVAGPGFVNVVLSKKWIAESLRRMLIDGINS
WAPRLPVKRALIDFSSPNIAKEMHVGHLRSTIIGDTLARMLEFSHVECVIRRNHVGDWGT
QFGMLITYLFEKFPNPDNVSEADIGDLQAFYKASKLRFDSDPEFKLRAQQAVVSLQSGEI
KYHKAWQQICEVSRAEFDKVYQCLGIQLEERGESFYNPYIPGVLEKLDNLGLIEESDGAR
VIYVEGVDIPLIAVKRDGGYNYFTTDLASLWYRLNEEKLEWIVYVTDIGQQQHFDMLFKA
YRRAGWLPKDENAYPKCTHIGFGLVLGEDGKRFRTRSSEVVRLVDLLDEAKRRCKIAILE
RDTTKDWSEEEIEKTSEAVGYGAVKYADLKINRLTNYTFNFDQMLNDKGNTAVYLLYAHA
RICSIIRKSGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVFEEACTNLLPNFLCEYLY
NLAEIFTKKFYANCQVVGSPEETSRLLLCEATVTVMRHCFYLLGIEHVYRL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgttagggttaggatgcttaaacctcaatcgattctctcacttcccatccactccctct
ctaccatcctctcgttccgatttactaaaggttgcatctcatagattcgctttatcagcg
actaaaacacagcaatcttcagtcactaagccacaatccacctccaccgctataattgaa
atagataacccagccagtgtcaaaaggcaactggcacaactgtttgatttgtctctgagg
gaaactgtgcctgatgagccacatgttgtgccattagttgatgcttgtgctgttaaaggt
ggtgcaaaatttggtgattatcaatgtaataacgcaatgggtatatggtctaggatgaaa
ggaaagcagacaggatttaggggtcccccggcaattggacaggccatcattaacaatctt
cctccatctgaaatgatagattcgtgctctgtagctggtcctggatttgtcaatgttgta
ttgtcaaagaagtggattgctgagagcttacgaagaatgctaatcgatggtatcaactcg
tgggcgcctcgacttccagtcaagagggctttgattgatttttcctctcctaatatagca
aaggaaatgcatgttggccacctgagatctaccattattggtgatacattagctcgcatg
cttgaattttcacatgtagaatgtgtaatccgtagaaatcatgttggtgactggggaaca
cagtttgggatgctgattacatacctctttgaaaaatttccaaacccagacaatgttagt
gaagcagacattggagatcttcaggcattctataaggcttcaaaactgaggtttgatagt
gatcctgagtttaagttgagggcacaacaggcagtggtcagtctccagagtggagaaatc
aagtatcacaaggcatggcaacaaatttgtgaagttagtagggctgaatttgataaagtc
tatcaatgtcttggaattcaattggaggaaaggggagagagcttctataatccatatatt
cctggggttttggagaagctggataatttaggactgattgaagagagtgatggtgcgcgt
gtgatttatgttgagggtgtagacataccacttattgctgtgaaaagagatggtggctac
aactattttacaactgatctagcatcactttggtatcgtctaaatgaagaaaaacttgaa
tggattgtatatgttacagatattgggcagcaacagcactttgatatgctatttaaggcc
tataggcgtgcaggttggttaccaaaggatgagaatgcgtatccaaaatgtactcatata
ggttttggtcttgttcttggggaagatggaaaacgatttcggactcgcagcagtgaggtt
gttcgattagttgatttacttgatgaagctaaaaggcgctgtaaaattgccattcttgaa
cgtgatacaactaaagattggtctgaggaggagatcgagaaaacatccgaggcagttggt
tatggggctgttaagtatgctgatttgaagatcaacagattaacaaattacaccttcaac
tttgatcagatgcttaatgacaaggggaatactgctgtttatttgctgtatgcacatgct
aggatctgttccattatcaggaaatctggtaaagacatagaagaagtaaagagaaatggg
aaaatagtgttggatcatgaagatgaacgtgcattggggcttcatttgctacaatttcct
gaggtttttgaggaggcatgcaccaatttgttgcccaatttcttgtgtgaatacctttac
aatttggcagaaatctttacaaaaaaattttacgctaattgtcaggttgtggggtcgcct
gaggaaaccagtagactcttgctatgtgaagcaacggtgactgtgatgagacactgcttt
tatctccttggaattgaacatgtatacaggctatga

DBGET integrated database retrieval system