KEGG   Glycine max (soybean): 100796274Help
Entry
100796274         CDS       T01710                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic-like
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100796274
   01230 Biosynthesis of amino acids
    100796274
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100796274
   00051 Fructose and mannose metabolism
    100796274
   00562 Inositol phosphate metabolism
    100796274
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100796274
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100796274
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100796274
  Exosomal proteins of bladder cancer cells
   100796274
  Exosomal proteins of melanoma cells
   100796274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDF
HVSAQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNEFVGDKVAYALQQ
GLKVIACIGETLEQREAGTTTAVVSEQTKAIAAKISNWDNVVLAYEPVWAIGTGKVATPA
QAQEVHADLRKWVHDNVSAEVAASVRIIYGGSVNGGNCKELAAQPDVDGFLVGGASLKPE
FVDIINAATVKKN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaaaattcttcgttggtggcaactggaaatgcaatgggaccactgaggaggta
aagaagattgttactactttgaatgaggctaaagtccctggagaagatgtcgtagaagtt
gttgtgagccctccttttgtgttccttcctgttgtaaaaagtttgctgcgccctgatttc
catgtttcggcacaaaactgttgggttcgcaaaggtggtgcttataccggtgaggttagt
gctgaaatgcttgttaatttgggaattccttgggttattattggtcactctgaacggagg
cagcttttaaatgaatcaaatgagtttgtgggagataaagttgcctatgcacttcaacaa
ggtctaaaagttattgcatgcattggggagactctcgaacagcgtgaagctggtacaaca
acggctgttgtttctgagcaaacaaaagcaattgcagctaaaatatcaaattgggacaat
gtcgttttggcctacgagccagtttgggccattggaacaggaaaggttgctactcctgct
caggctcaagaggtccatgctgatttgaggaaatgggttcatgacaatgtgagtgctgaa
gttgctgcatctgtaagaattatctatggaggttctgtaaatggaggaaactgcaaagaa
ttggccgcacagcccgatgttgatggatttttggttggtggtgcctccctgaagccggag
ttcgtggacatcataaatgctgccactgtgaagaagaattga

DBGET integrated database retrieval system