KEGG   Glycine max (soybean): 100796355Help
Entry
100796355         CDS       T01710                                 

Definition
probable protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gmx04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 362 aa AA seqDB search
MWSSKTTLMFGVAAIALMMFLSSASADDVVALTEETFENEVGKDRAALVEFYAPWCGHCK
RLAPEYEQLGTTFKKTKSVLIAKVDCDEQKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGA
RTAEALAAFVNIEAGTNVKIASVPSSVVVLSPDNFDEVVLDETKDVLVEFYAPWCGHCKA
LAPIYEKVAAAFNLDKDVVMANVDADKYKDLAEKYGVSGYPTLKFFPKSNKAGEDYNGGR
DLDDFVAFINEKCGTYRDGKGQLTSKAGIIASLDDLVKEFVSADSNEKKAVYSRLEEEVK
KLKGSSARHGDLYLKLAKKGIEKGADYAKNEIQRLERMLEKSISPAKADEFTLKKNILST
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctccaaaacgacattgatgtttggcgtcgcagccattgctctgatgatgttt
ctctcatctgcttcagcggacgacgtcgttgcactcacagaggaaaccttcgaaaacgag
gttggcaaggatcgtgccgctctcgtcgagttttacgctccctggtgtggacactgtaaa
aggcttgcaccggagtacgaacagctcggaacgacttttaagaaaacgaagtccgttttg
attgccaaggtggattgtgatgaacagaaaagtgtttgtagtaaatatggggtatctggt
taccctaccattcaatggtttcctaagggatctctagagcctaaaaagtatgaaggtgca
cgtactgcagaagcccttgcggcgtttgtgaacattgaagcaggtacaaatgtgaagata
gcttctgttccatccagtgtggtagttctctctccagataactttgatgaggttgtcttg
gatgaaacaaaagatgttctggtggaattctatgcaccatggtgcggtcattgcaaggcc
cttgcccctatttatgagaaggttgctgcagcatttaacctggataaagatgtagttatg
gccaatgttgatgctgacaagtataaagatttggctgagaaatatggtgttagtggctat
cctacactgaagtttttcccaaagagcaacaaagctggtgaagattataatggtggccgt
gatttggatgattttgtagcattcatcaatgagaaatgtggcacctaccgtgatgggaag
ggacagcttacttctaaggctggtataatagcatctctggatgacttggtgaaggagttt
gtgagtgctgacagtaatgagaagaaggcagtatattcccggcttgaggaggaagttaag
aagcttaaaggttcttctgccagacatggcgacctctacttaaaacttgctaagaagggt
atagaaaaaggtgcagactatgcaaagaatgaaattcaacgtcttgagcgcatgcttgag
aagtcaatcagcccagcaaaagcagatgaattcactctcaagaagaacatcttatctacc
tttgcttga

DBGET integrated database retrieval system