KEGG   Glycine max (soybean): 100796687Help
Entry
100796687         CDS       T01710                                 

Definition
SNF1-related protein kinase catalytic subunit alpha KIN10-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gmx  Glycine max (soybean)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100796687
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100796687
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100796687
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100796687
  Mitophagy factors
   Other mitophagy factors
    100796687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 514 aa AA seqDB search
MDGPAGRGGAGLDMFLPNYKLGKTLGIGSFGKVKIAEHVLTGHKVAIKILNRRKIKNMEM
EEKVRREIKILRLFMHPHIIRLYEVIETPTDIYVVMEYVKSGELFDYIVEKGRLQEDEAR
NFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSP
NYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHL
SPGARDLIPGMLVVDPMRRMTIPEIRQHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQE
VVKMGFDRNQLVESLGNRIQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMDSGFNQMHSS
ELASSVVGNRFPGYMEYPGVGSRQQFPVERKWALGLQSRAHPREIMTEVLKALQELNVCW
KKIGHYNMKCRWVAGIPGHHEGMVNNNVHSNHYFGDDSNIIENDAVSTSNVVKFEVQLYK
TREEKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggatggaccagctggccgaggtggtgctggcctggacatgtttctaccaaattataaa
ttgggaaaaacactcgggattggatcttttggcaaggtgaaaattgcagaacatgtgttg
actggccataaggttgcgatcaagatccttaaccgacgcaagataaagaacatggaaatg
gaagaaaaagtgagaagagaaatcaaaattttaagattgttcatgcatcctcacattatt
cgactttatgaagtcatagaaactccaactgacatatatgttgtcatggagtatgtgaag
tctggagagcttttcgattacatagtagagaagggtaggttgcaggaagatgaagctcgt
aatttttttcagcagataatctctggggtggagtactgtcacaggaatatggtggttcat
agagatttgaagcctgagaatttacttttggactccaaatgtaatgtcaagattgctgat
tttggcttgagcaacatcatgcgtgatggtcactttcttaaaacaagttgtggaagccct
aactatgcagctcctgaggttatctctgggaaattgtatgctggacctgaagtggatgtc
tggagctgtggtgtaattttatatgcccttctttgtggcacccttccttttgatgatgaa
aatattccaaatctcttcaagaaaataaagggtgggatttacactcttcccagtcatcta
tcacccggtgctagagatttgataccagggatgcttgtggttgaccctatgaggagaatg
accatacctgagatccgtcaacacccatggttccaagctcgacttccacgttatttagct
gtgccaccaccagatacaatgcaacaggccaaaaagattgatgaggagatccttcaggaa
gtggtgaaaatgggatttgacaggaatcaattggttgaatctcttgggaacaggatacaa
aatgagggtactgtggcatactatttgttattggacaaccgatttcgtgtttccagtggc
tatcttggagctgagtttcaagagaccatggattccggttttaatcaaatgcattccagt
gaacttgcttcttcagttgttggaaaccgctttccaggctacatggaatatccaggagta
ggatcgaggcaacagttccctgttgaaaggaaatgggcccttgggcttcagtctcgagcc
catcctcgtgaaataatgactgaggttcttaaagctttgcaagaattaaatgtttgttgg
aagaagattggtcactacaacatgaagtgtaggtgggttgctggcattcctggtcaccac
gaaggaatggttaacaataatgtgcatagtaatcattactttggagatgattccaacatt
attgagaatgatgctgtttctacttcaaatgtggtcaagtttgaagtgcagctttacaaa
acccgggaagaaaagtatctgcttgatcttcaaagggtgcagggtccacagtttcttttc
ttggatctatgtgctgctttccttgcacagcttcgtgtcctctag

DBGET integrated database retrieval system