KEGG   Glycine max (soybean): 100796746Help
Entry
100796746         CDS       T01710                                 

Definition
aspartate carbamoyltransferase 3, chloroplastic-like
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gmx  Glycine max (soybean)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100796746
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100796746
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     100796746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 398 aa AA seqDB search
MAASSSLFSSSMHREMLAPKTSKCPQNFVCCHSKISYMEPNYLKQVCCPNSRFLSMNMSS
KWEQMDRRDAFHCRALKTERAPTFSVGQKFQLNDIIEAQQFDRDILSAIFEVAQDMENVE
KDSPDNQLLKGYLMATLFYEPSTRTRLSFESAMRRLGGEVLTTENAREFSSAAKGETLED
TIRTIEGYSDIIVMRHFESGAARRAAATSDIPIINAGDGPGQHPTQALLDVYTIQREIGK
IDGIKVGLVGDLANGRTVRSLAYLLAKFKDVKIYFVSPDVVKMKDDIKDYLTSKGVEWEE
SSDLVEVASECDVVYQTRIQKERFGERIDLYEKARGKYVVNQGILNVMQRHAVVMHPLPR
LDEITVDVDADPRAAYFRQAKYGLYIRMALLKLLLVGW
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcttcttctcttttctcctcttcaatgcatagggagatgcttgctccaaag
acatcaaagtgcccccaaaattttgtatgctgtcatagcaaaatttcctatatggaacct
aattatttaaaacaagtatgctgtcctaattcgagatttttaagtatgaatatgtcatca
aaatgggaacaaatggatcgaagagatgcattccattgtcgtgctttgaaaactgaacgt
gcacctaccttttcagtggggcagaaatttcaactaaatgatattattgaagctcaacag
tttgatcgagatattctcagtgccatttttgaagttgcacaggatatggagaatgttgaa
aaggattcgcctgataaccagcttttaaagggttatctaatggctaccctattttatgag
ccctctactagaactagactttcatttgagtctgccatgagaagactgggtggagaggtt
ttaactactgaaaatgcgagagaattttcatctgcagctaaaggagagacacttgaagat
acaatcagaacaattgagggttactctgatataattgtgatgcggcattttgaaagtggt
gctgccagaagagctgcagctacatctgacattccaataatcaatgcaggggatggtcct
ggacaacatccgactcaggcacttttagatgtctatacaattcaaagagagattggaaag
attgatggcataaaagttgggcttgtgggagaccttgctaatggcaggactgttcgttca
ttggcatacttgcttgctaaattcaaggatgtgaaaatttattttgtctctcctgatgtg
gtaaaaatgaaggatgatataaaagactatttgacatcaaagggagtggagtgggaagaa
tcttctgatttagtagaagtggcctcagagtgtgatgttgtttatcaaactcgtattcaa
aaggaaagatttggcgaaagaatcgacctttatgaaaaggctagaggcaagtacgttgtg
aatcagggtattctcaatgtgatgcagagacatgctgtggttatgcaccctcttccaaga
cttgatgaaatcactgtggatgttgatgctgatccaagggctgcttactttaggcaggcc
aaatatggtctatatattcggatggctctattgaaactcttgcttgttgggtggtag

DBGET integrated database retrieval system