KEGG   Glycine max (soybean): 100797022Help
Entry
100797022         CDS       T01710                                 

Definition
asparagine synthetase, root [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gmx  Glycine max (soybean)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100797022
Enzymes [BR:gmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100797022
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C44
   100797022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 582 aa AA seqDB search
MCGILAVLGCSDDSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD
QPLFNEDKSVIVTVNGEIYNHEELRKQLPNHKFRTGCDCDVIAHLYEEHGEDFVDMLDGI
FSFVLLDTRDNSFIVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFECFPPGHLY
SSKERGFRRWYNPPWFSEATPSTPYDPLVLRHTFEQAVIKRLMTDVPFGVLLSGGLDSSL
VASVTSRYLANTKAAEQWGSKLHSFCVGLEGSPDLKAAKEVADYLGTVHHEFTFTVQDGI
DAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPN
KEEFHRETCRKIKALHQYDCLRANKSTFAWGLEARVPFLDKAFINTAMSIDPESKMIKRD
EGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVGYSWIDGLKAHAAKHVTDKMMLN
AGNIYPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGGASVACSTAKAVEWDAAWSNNLD
PSGRAALGVHISAYENQNNNKGVEIEKIIPMDAAPLGVAIQG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattcttgctgttcttggttgttctgatgactctcgagccaaaagggtccgc
gtgcttgagctctctcgcagattgaagcaccgtggccctgactggagtgggctccatcaa
catggtgactgctttttagcacatcaacggttagccatagttgatcctgcttctggggat
caacctctctttaacgaggacaaatccgtcattgtcacggtgaatggagagatttacaac
catgaagagctcaggaaacagctgcctaatcacaagttccgtactggatgtgattgtgat
gttattgcacacctgtacgaggaacatggagaagactttgtggacatgctggatggtatc
ttctcatttgttctactggacacccgtgacaacagttttatagtggctcgggatgctatt
ggggtcacttccttgtacattggatggggattagatggctctgtttggatttcatcagaa
atgaaaggcctgaatgatgattgtgaacactttgagtgttttccacctggtcacttgtac
tctagcaaagaaagagggtttcgcagatggtacaatcctccttggttctctgaggctact
ccatccaccccttatgatcctctcgttttaagacacacctttgagcaggcagtcataaaa
agattgatgactgatgtgccttttggtgttctactctctggaggtttggactcttcattg
gttgcatccgtcacttctcgctacttggccaacacaaaggctgctgagcagtggggatca
aagttacattcattctgtgtaggccttgagggctcaccagatttgaaggctgcaaaagaa
gttgctgactatctaggcactgtccaccatgagtttaccttcactgttcaggatggaata
gatgccattgaagatgttatctaccatgttgaaacatatgatgtgactacaattagagct
agcacacccatgtttctcatgtctcggaagattaaatcacttggtgtcaaatgggttatc
tccggagaaggatctgatgagatctttggagggtatctgtacttccacaaggcacccaac
aaggaggagtttcacagagaaacatgccgcaagatcaaagcactccaccaatatgattgc
ttgcgagccaataaatcaacatttgcttggggtctagaagcccgtgtaccatttttggac
aaggcatttatcaatactgcaatgagtattgaccctgagtcgaaaatgataaaaagagat
gaaggacgaattgagaagtggattctgaggagagcctttgatgatgaagagcatccttat
ctgccaaagcacattttatacaggcagaaagagcaattcagtgatggagttggctatagc
tggattgatggccttaaggcccatgctgcaaaacatgtgactgacaaaatgatgcttaat
gctggtaacatctaccctcacaacaccccaacaaccaaggaagcatattactacagaatg
atctttgagaggttcttccctcagaactcagctaggctcaccgttcctggaggagcaagt
gttgcatgtagcacagccaaagctgttgagtgggatgctgcttggtctaacaaccttgat
ccttctggtagagcagcacttggagtgcacatttcagcctatgaaaaccagaacaacaac
aagggtgtagaaattgagaagattatacctatggatgctgctcctcttggtgttgcaatc
cagggataa

DBGET integrated database retrieval system