KEGG   Glycine max (soybean): 100797022Help
Entry
100797022         CDS       T01710                                 

Definition
asparagine synthetase, root [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gmx  Glycine max (soybean)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gmx00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 582 aa AA seqDB search
MCGILAVLGCSDDSRAKRVRVLELSRRLKHRGPDWSGLHQHGDCFLAHQRLAIVDPASGD
QPLFNEDKSVIVTVNGEIYNHEELRKQLPNHKFRTGCDCDVIAHLYEEHGEDFVDMLDGI
FSFVLLDTRDNSFIVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFECFPPGHLY
SSKERGFRRWYNPPWFSEATPSTPYDPLVLRHTFEQAVIKRLMTDVPFGVLLSGGLDSSL
VASVTSRYLANTKAAEQWGSKLHSFCVGLEGSPDLKAAKEVADYLGTVHHEFTFTVQDGI
DAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPN
KEEFHRETCRKIKALHQYDCLRANKSTFAWGLEARVPFLDKAFINTAMSIDPESKMIKRD
EGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVGYSWIDGLKAHAAKHVTDKMMLN
AGNIYPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGGASVACSTAKAVEWDAAWSNNLD
PSGRAALGVHISAYENQNNNKGVEIEKIIPMDAAPLGVAIQG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattcttgctgttcttggttgttctgatgactctcgagccaaaagggtccgc
gtgcttgagctctctcgcagattgaagcaccgtggccctgactggagtgggctccatcaa
catggtgactgctttttagcacatcaacggttagccatagttgatcctgcttctggggat
caacctctctttaacgaggacaaatccgtcattgtcacggtgaatggagagatttacaac
catgaagagctcaggaaacagctgcctaatcacaagttccgtactggatgtgattgtgat
gttattgcacacctgtacgaggaacatggagaagactttgtggacatgctggatggtatc
ttctcatttgttctactggacacccgtgacaacagttttatagtggctcgggatgctatt
ggggtcacttccttgtacattggatggggattagatggctctgtttggatttcatcagaa
atgaaaggcctgaatgatgattgtgaacactttgagtgttttccacctggtcacttgtac
tctagcaaagaaagagggtttcgcagatggtacaatcctccttggttctctgaggctact
ccatccaccccttatgatcctctcgttttaagacacacctttgagcaggcagtcataaaa
agattgatgactgatgtgccttttggtgttctactctctggaggtttggactcttcattg
gttgcatccgtcacttctcgctacttggccaacacaaaggctgctgagcagtggggatca
aagttacattcattctgtgtaggccttgagggctcaccagatttgaaggctgcaaaagaa
gttgctgactatctaggcactgtccaccatgagtttaccttcactgttcaggatggaata
gatgccattgaagatgttatctaccatgttgaaacatatgatgtgactacaattagagct
agcacacccatgtttctcatgtctcggaagattaaatcacttggtgtcaaatgggttatc
tccggagaaggatctgatgagatctttggagggtatctgtacttccacaaggcacccaac
aaggaggagtttcacagagaaacatgccgcaagatcaaagcactccaccaatatgattgc
ttgcgagccaataaatcaacatttgcttggggtctagaagcccgtgtaccatttttggac
aaggcatttatcaatactgcaatgagtattgaccctgagtcgaaaatgataaaaagagat
gaaggacgaattgagaagtggattctgaggagagcctttgatgatgaagagcatccttat
ctgccaaagcacattttatacaggcagaaagagcaattcagtgatggagttggctatagc
tggattgatggccttaaggcccatgctgcaaaacatgtgactgacaaaatgatgcttaat
gctggtaacatctaccctcacaacaccccaacaaccaaggaagcatattactacagaatg
atctttgagaggttcttccctcagaactcagctaggctcaccgttcctggaggagcaagt
gttgcatgtagcacagccaaagctgttgagtgggatgctgcttggtctaacaaccttgat
ccttctggtagagcagcacttggagtgcacatttcagcctatgaaaaccagaacaacaac
aagggtgtagaaattgagaagattatacctatggatgctgctcctcttggtgttgcaatc
cagggataa

DBGET integrated database retrieval system