KEGG   Glycine max (soybean): 100797088Help
Entry
100797088         CDS       T01710                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100797088
  Lipid metabolism
   00561 Glycerolipid metabolism
    100797088
   00600 Sphingolipid metabolism
    100797088
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100797088
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100797088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 420 aa AA seqDB search
MAMQYSFSSWSRRLPMEIMVLALCILVLLHGNPSTARLLVNGSRRLSVLTERRNLVQSGL
GQTPPMGWNSWNHFGCDVNESVVRETADAMMSTGLAALGYQYVNIDDCWAELNRDTEGNM
VPNAASFPSGIKALADYVHSKGLKLGIYSDAGNQTCSKRMPGSLGHEEQDAKTFASWGVD
YLKYDNCENNGIKATDRYPPMSEALLKTGRPVFFSMCEWGWQDPATWAKTVGNSWRTTGD
IEDNWNSMTNIADANDQWVSYAGPGGWNDPDMLEVGNGGMTTEEYRAHFSIWALAKAPLL
VGCDIRSMDKTTFELISNPEVIAVNQDKEGVQGKKVKSNNDLEVWAGPLIDNKVAVVLWN
RSSSNATVTASWSDIGLEPGTMVDAKDLWANTTQQSVSGEISAQLDSHACKMYVLTPKSP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcaatattcattctcgagttggagccgcaggttacccatggagattatggtg
cttgccttgtgcatccttgtgcttttgcatggaaatccttcaactgctcgcttattagtg
aacggtagcagaagattgtctgtgttgacggagaggagaaacctggtccaaagtggcctc
ggccaaacacctcccatggggtggaatagctggaatcattttggctgcgatgttaatgaa
agtgtagttcgagaaacagctgatgcaatgatgtcaacggggctcgctgctttggggtac
caatatgtaaatatagatgactgttgggccgaacttaatcgagatactgagggcaatatg
gttcccaatgctgcatcatttccttcaggaattaaggctctggctgattatgttcacagc
aaaggtctaaagttggggatctattcagatgctggaaatcaaacatgcagcaaacgtatg
cctggatcactgggacatgaagaacaagatgcaaagacatttgcttcttggggagttgac
tatttgaagtacgataattgtgaaaataatggtataaaagccacagacaggtatccacca
atgagtgaagctttattaaaaactggaaggccagtcttcttctctatgtgtgaatgggga
tggcaagacccagcaacttgggccaaaactgtgggaaatagttggagaacaacaggagat
attgaggataactggaatagcatgactaacatagcagatgcaaatgaccaatgggtatct
tatgctggacctggaggatggaatgatccggacatgctggaagttggaaatggaggcatg
accacagaagaatatcgtgcccatttcagcatatgggctttagctaaggctcctttattg
gttggttgtgatattcgatcaatggacaagacaacatttgaactgataagcaacccggaa
gttattgcagtaaaccaagataaagaaggtgttcaaggaaagaaagtgaaaagcaataac
gatttggaggtgtgggcaggtcctctcattgataacaaggtagctgtggtcttatggaat
agaagttcatcaaatgcaacagtgactgcgtcctggtctgacataggcctcgaaccagga
actatggttgatgcaaaagatttatgggcgaatactactcaacaatcggtttcaggagaa
atctctgctcaattagattcacatgcatgcaagatgtatgttctgactccgaagagccct
tga

DBGET integrated database retrieval system