KEGG   Glycine max (soybean): 100798154Help
Entry
100798154         CDS       T01710                                 

Definition
uncharacterized LOC100798154
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 380 aa AA seqDB search
MSSQNQNRSLEQAGPSGSGGQVGVRVVNWSGSDRLCISPKRDHKPENYDDLQFEFNPNIF
ASLEHYLPPHMLNLSRDVKLHYIRNILLRYLPENDRIWIQKLREYRLKIILNYPPLHKEI
FTMDAESFFVPSFLRAIKENTEASFRSIMAEPCKGVYTFEMLQPQFCKKLMSEVDHFERW
VHGTKLRIMRPNAMNKNKHGVILDDFAFEAMLDRFMCDFIQPISRVFYPELGGSSLDSHH
GFVVEYGINKDVELGLHEDEAEVTLNVCLGKEFSGGDLFFQGVRCDAHVTTNTQPEEAFN
YSHVPGHAILHPGRNRHGTRPTTSGNRMNLILWCRSSAFIELKRYQRDFYSWCAECRRKK
AERVRLSVVAAKQELLKSEI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcagaatcagaataggtcgttggagcaagctggaccctccggctccggtgga
caggtgggagtgagagtagtgaattggagtggttccgataggctttgcataagccctaag
cgagatcacaagcccgaaaactatgacgaccttcaattcgagttcaatcctaatatcttc
gcctctctcgagcactatttgcctcctcatatgctcaacctctcacgtgatgttaagctt
cactacatcaggaacattcttcttcgctatttgcctgagaatgaccgcatttggattcaa
aagctgagggaatacaggctaaagatcatattgaattatccaccgctgcataaggagata
tttactatggatgctgagagctttttcgtaccatcatttctcagagcaataaaagaaaac
acagaagcgagttttagaagtataatggctgaaccttgtaaaggagtttatacatttgaa
atgcttcaaccacaattttgtaaaaaactgatgtctgaggtggatcattttgaaagatgg
gtccatggtaccaaactcagaatcatgcgacctaatgcaatgaataaaaataaacatggt
gttattcttgatgattttgcctttgaagccatgcttgacagatttatgtgtgatttcata
caacctatatctcgagttttctaccctgaacttggtggatcctcactggactctcaccat
ggttttgttgttgaatatggaattaataaggatgtggaacttggcttacatgaggatgag
gcagaagtcaccttaaatgtttgcttgggaaaagaattttctggtggagacctgttcttc
cagggtgttcgatgtgatgcacatgtaactacaaatacgcaaccagaggaggccttcaat
tattcccatgtcccaggacacgcaattcttcatcctggtcgtaaccggcatggcactaga
cctacaacatctgggaatcggatgaatttaattctctggtgtagaagttcggcttttata
gagttgaagcgatatcaaagagatttttatagctggtgtgcagaatgcagacgcaagaag
gcagagagagtgcgtttgtcagttgtggccgccaaacaggaattactaaagagcgaaata
taa

DBGET integrated database retrieval system