KEGG   Glycine max (soybean): 100798318Help
Entry
100798318         CDS       T01710                                 

Definition
(RefSeq) asparagine synthetase [glutamine-hydrolyzing] 2
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00250  Alanine, aspartate and glutamate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100798318
Enzymes [BR:gmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100798318
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C44
   100798318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 100798318
NCBI-ProteinID: XP_003538303
UniProt: I1LLM2
Position
11
AA seq 579 aa AA seqDB search
MCGILAVLGCSDSSQAKRVRVLELSRRLKHRGPDWSGLHQYGDNYLAHQRLAIVDPASGD
QPLFNEDKTVVVTVNGEIYNHEELRKQLPNHTFRTGSDCDVIAHLYEEHGENFVDMLDGI
FSFVLLDTRDNSFIVARDAIGVTSLYIGWGLDGSVWISSELKGLNDDCEHFESFPPGHLY
SSKERAFRRWYNPPWFSEAIPSAPYDPLALRHAFEKAVVKRLMTDVPFGVLLSGGLDSSL
VAAVTARYLAGTNAAKQWGTKLHSFCVGLEGAPDLKAAKEVADYIGTVHHEFHYTVQDGI
DAIEDVIYHIETYDVTTIRASIPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPN
KEEFHQETCRKIKALHKYDCLRANKSTFAWGLEARVPFLDKDFIRVAMNIDPDYKMIKKE
EGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVGYGWIDGLKAHAEKHVTDRMMLN
AANIFPFNTPTTKEAYYYRMIFERFFPQNSARLSVPGGPSVACSTAKAVEWDAAWSNNLD
PSGRAALGVHASAYGNQVKAVEPEKIIPKMEVSPLGVAI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatacttgctgtgcttggttgctctgattcatctcaagccaaaagggttcgc
gtccttgagctttctcgcagattgaagcaccgtggtcctgactggagtgggctccaccaa
tatggtgataactatttggctcatcaaaggttagccatagttgatccagcttctggtgat
caacccctcttcaatgaagacaaaactgtcgtggttacggtgaatggagagatctacaat
catgaagaactcaggaaacagttgcctaatcacaccttccgtacaggaagtgactgtgat
gttattgctcacctgtatgaggagcacggagaaaactttgtggacatgcttgatggtata
ttttcgtttgttctgctagatactcgtgacaacagttttatagtggcacgagatgcaatt
ggggtcacttccttgtacattggttggggtctagatggctccgtctggatttcatcagaa
ttgaaggggttgaatgatgattgcgaacattttgagtcttttccacctggtcacttgtac
tctagcaaagagagagcgttccgcagatggtacaatcctccatggttctctgaggctatt
ccctcagcaccttatgatcctcttgctttgaggcatgcctttgagaaggctgtggtaaaa
aggttgatgactgatgttccctttggtgttttgctctctggaggtttggactcttcattg
gttgcagccgtcacggctcgctacctggcaggcacaaatgctgccaagcaatggggaacc
aaattacactctttctgtgtaggccttgagggtgcacctgacctaaaggcagcaaaggaa
gtagcagactacataggaactgtacatcatgaatttcactacactgttcaggatggcata
gatgccattgaggatgtgatctatcacattgaaacatatgatgtgacaacaattagagca
agcattcccatgtttcttatgtctcgtaagatcaagtcattgggagtcaaatgggttata
tctggagaaggatctgatgagatctttggagggtatctatatttccacaaggcaccaaac
aaagaagagtttcatcaagaaacatgccgcaagattaaagcactccacaaatatgattgc
ttgcgagccaataaatcgacctttgcctggggtctagaagccagagtgccatttttggac
aaagattttatcagagttgcaatgaacattgatcctgattataaaatgattaaaaaggaa
gaagggcgaattgagaaatgggtactgaggagggcctttgatgatgaagaacatccttat
ctgccaaagcacattttatacaggcagaaagaacaattcagtgatggagttggctatggt
tggattgatggccttaaagctcatgctgagaaacatgtgactgacagaatgatgctcaat
gctgctaacattttccccttcaacacaccaaccaccaaagaagcatactactatagaatg
atatttgagaggttcttccctcagaactcagccaggctgagtgttcctggaggaccaagt
gttgcatgtagcacagccaaagctgtagagtgggatgctgcttggtctaacaaccttgat
ccatctggtagggcagcacttggagtgcatgcatcagcttatggaaatcaggtcaaagct
gtagaaccagagaagatcataccaaagatggaagtttccccactaggagttgccatatag

DBGET integrated database retrieval system