KEGG   Glycine max (soybean): 100798519Help
Entry
100798519         CDS       T01710                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
gmx  Glycine max (soybean)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100798519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 256 aa AA seqDB search
MEEETERFSCSKLLIPKGEPIFVKATWFPTHFHLAVTDGITAWHCHPSAEEVKQRAAQWD
LPVSEYLNLSERYLGLQQPGSVYAFDDAGDSHKRLSWTFEKEGMTLLWRWKCLLSPDSKK
SNVEILDFLMGSNINLSDKVVTENELFEKMKVEAEKCLTQSERIANERLEFESEIYAKFL
GVLNSKKSKLRVLRDKLSKQENSEKSPEEEDTDKTESFDEENDFERSDEDPQKDITSSSK
EVMANKPSHPKRIRHK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaaacagagaggttctcctgctccaagcttctcattccaaaaggagaaccc
attttcgtgaaggccacttggtttcccacccactttcacctcgccgtcaccgacggcatc
accgcctggcactgccacccatcggcggaggaagtgaagcagcgtgctgctcagtgggac
ctcccagtttcagagtacctgaacttgtctgaacgctatttggggcttcaacaacctggc
tctgtctatgcatttgatgatgctggtgatagccataagaggttgtcatggacgtttgag
aaggaaggaatgactctgctttggagatggaaatgcttgctgtctcctgattctaagaaa
agtaatgtcgaaatattggactttctcatgggttcaaacataaatctaagtgacaaagtt
gtcacagaaaatgaattgtttgagaagatgaaagtggaagctgagaagtgcttaacccag
agtgaaagaattgccaatgagaggctggaatttgaatctgaaatctatgcaaagtttctg
ggggtgttaaattctaaaaagtcaaaactgagagtgcttcgagataagctgtcaaagcaa
gagaattctgagaaatctcctgaagaggaagacacagacaaaactgagagttttgacgaa
gaaaatgattttgaaagaagtgatgaagatcctcaaaaggatattactagttcttcaaag
gaagttatggcaaataagccttctcatccaaaaagaattagacacaaatga

DBGET integrated database retrieval system