KEGG   Glycine max (soybean): 100798863Help
Entry
100798863         CDS       T01710                                 

Definition
mitogen-activated protein kinase homolog NTF3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 371 aa AA seqDB search
MATPVEPPNGIRTEGKHYYSMWQTLFEFDSKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKIQNAFENRVDALRTLRELKLLRHLHHENVIALKDIMMPVHRNSFKDVYLVYELMDTDL
HQIIKSSQALSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTNCSKNQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGSECL
NQLKLIINILGSQREEDIEFIDNPKAKKYIKSLPYSPGSPFSRLYPNAHPLAIDLLAKML
VFDPTKRISVTEALQHPYMAPLYDPNCDPPAVIPIDLDIDEDLGEEMIREMMWKEMLHYH
PESAMENAGLC
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcctgttgagcctcctaacgggatcagaactgaagggaagcattattattcc
atgtggcaaaccctgtttgagtttgattcaaaatacgtgcccatcaagccaattggccgc
ggagcatatgggattgtgtgctcttctgtgaatagagagacaaatgagaaggttgccatc
aagaagatacagaatgcctttgaaaaccgggttgatgcactgaggactttgcgcgaactc
aagcttcttcgccaccttcaccatgagaatgtgattgctttgaaggatatcatgatgcct
gttcataggaatagtttcaaggatgtctatctagtttatgaactcatggacacggatttg
catcagattattaagtcttctcaagctttgtctaatgatcactgccagtatttcctcttt
cagttgctccgtggcttgaaatatcttcactcagctaacatccttcatcgtgacttgaaa
cctgggaatcttctaattaatgcaaattgtgacctaaaaatatgcgattttgggttagca
cgtactaactgcagcaagaaccagttcatgaccgagtatgttgtcactcggtggtatagg
gcaccagagctcctactctgctgtgacaactatgggacatctattgatgtttggtcagtt
ggatgcatctttgcagagcttcttggccgaaaaccgattttccctggttcagagtgtctc
aaccagctgaagttgattatcaatatccttggtagtcagagggaggaggatattgaattc
attgataatccaaaggcaaagaagtatatcaaatcacttccttattctcctggaagcccc
ttttcgcgactttatcctaatgcgcatccattagcaattgatcttcttgcaaagatgctt
gtttttgatccaaccaagaggattagtgtcactgaagcacttcaacacccttacatggcc
cctctgtatgatcctaactgtgaccctccagctgtcattccaattgatcttgacattgat
gaggatctaggggaagagatgataagggagatgatgtggaaagaaatgcttcattaccat
cccgaatctgcgatggagaatgcagggttgtgctaa

DBGET integrated database retrieval system