KEGG   Glycine max (soybean): 100799027Help
Entry
100799027         CDS       T01710                                 

Definition
(RefSeq) phosphoinositide phospholipase C 6-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gmx  Glycine max (soybean)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100799027
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100799027
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100799027
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100799027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 556 aa AA seqDB search
MASHNYKVFSCFNRKFTVTEPGPPPDVERAFSEFAAGASSLSGDHILRFLAEHQGDVDCT
AADSERMLQQSRKEDRESGMDLHDFFRFLLHDDFNSPIKSQVHHDMNAPLSHYFIYTGHN
SYLTGNQLSSDCSDVPIIKALQGGVRVIELDLWPNSDKDDIEVVHGRTLTTPVSLIQCLK
SIKEYAFVKSHYPLIITLEDHLTPDLQAKAAEMATQVFGELLYYPQTDSLMEFPSPESLK
GRILISTKPPKEFLESKECDDKDNEKESADEVLSLPDQTSERETDDKSAPEYKRLITIHA
GKPKGDIQDELKAAGAVRRLSLSEQALEKASESYGADIVRFTQNNILRVYPKGTRLNSSN
YKPHIGWTYGAQMVAFNMQGYGKSLRYMQGMFRANGGCGYVKKPEFLIEKGPYNEVFDPK
RTLPVKKTLKVKVYMGTGWSLDFSQTDFDTYSPPDFYVKVCIVGVPADMAKKKTCVISNN
WFPVWDEQFDFPLTVPELALLRIEVRENDKSQKDDFGGQTCLPVSELKSGFRSVPLYDEK
GDKLKSVKLLMRFQFR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcacaactacaaagtcttcagctgcttcaacaggaagttcaccgtcaccgag
ccgggcccaccgcccgacgtagaaagagcgttttctgaattcgccgccggcgcctcctcc
ctgtccggcgatcacatcctccggtttctggcggagcaccagggcgatgtggactgcacc
gcagcggattcggagcggatgctccagcaatcgcggaaagaggatcgggaaagtggaatg
gatctccacgacttcttccgtttcctgctacatgacgatttcaatagccccatcaaatct
caggtacatcatgatatgaatgctccattgtcacattatttcatatatactgggcacaat
tcctatcttactgggaatcaactgagcagtgactgcagtgatgtaccaatcataaaggct
ttgcaaggaggtgtaagagtaattgaactagatttatggccaaattcagacaaagatgat
atcgaagtagttcatggaaggactcttacgactcctgtctcactcatccaatgtttgaag
tccataaaagagtatgcttttgttaaatctcactacccactcattataactttagaagat
caccttactccagatcttcaagctaaagctgcagagatggcaactcaagtatttggagaa
ttgctttattatcctcagacagattctctgatggaattcccctcaccggaatcattgaaa
ggtcgaattcttatatcaacaaaaccaccaaaagaatttcttgaatccaaagaatgtgat
gacaaggacaacgaaaaggaatcagccgacgaggttttgtcattgccagaccaaacaagt
gaacgggaaactgatgataagagtgcacctgagtacaaacgattgattacaatccatgct
gggaaaccaaagggtgatattcaggatgaattaaaagctgctggtgctgttaggcgctta
agcttgagtgaacaagcacttgaaaaggcttctgaatcttatggagctgatattgttagg
tttacgcagaacaatattctcagagtatatccaaagggaacacgtctcaattcctcaaat
tacaagccacacatagggtggacatacggagctcagatggttgcgttcaacatgcagggg
tatggaaaatcacttcggtacatgcaaggaatgtttagagcaaatggagggtgcggttat
gtgaaaaagcctgaatttctaattgaaaaaggtccatataatgaggtttttgatcctaaa
agaacattgcccgtgaagaaaacattaaaggtaaaagtctatatggggaccggttggagc
ttagatttcagccaaacagacttcgatacttactcaccacccgacttttacgttaaggtt
tgtattgttggagttccagctgatatggccaagaagaaaacatgtgtaatttcaaataac
tggtttcctgtctgggatgaacagtttgatttccctttgactgttccagagctggctttg
ctccgcatagaagttcgagagaatgacaagagtcaaaaggatgactttggtggacagacg
tgtttgcctgtctcagagctaaaatctggattccgatcagtccctctgtatgatgaaaag
ggtgacaaattaaagtctgtgaagcttctaatgcggtttcagtttagatga

DBGET integrated database retrieval system