KEGG   Glycine max (soybean): 100799149Help
Entry
100799149         CDS       T01710                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gmx  Glycine max (soybean)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gmx00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gmx00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 464 aa AA seqDB search
MFGVVRRRVASGSPSPWLLGQSAQKIRSGPSVSARASSIVEKEIVFRSGGCGFVQNFSHI
TPGSWINSKPMRVVIHPEATVRTWGRLFSSESGDTVDVVVPPLAESISDGTLAQFLKRPG
DRVNADEPIAQIETDKVTIDVSSPESGVILKLLANEGDTVEPGNKIAIISRSADATHVAP
SETISEKAAPQPTQKVSEEKKAPKVETAPAKEKPKTPPATLKSPTEPQLPPKERERRVPM
TRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFVEKHGVKLGLMSGFVKA
AVNALQHQPIVNAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNADTMNFADIEKQINT
FAKKANDGSLSIDEMAGGTLTISNGGVYGSLLSTPIINPPQSAILGMHSIVSRPTVVGGN
IVPRPMMYVALTYDHRIIDGREAVFFLRRIKDIVEDPRRLLLDI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgtcgtaaggcgaagggttgcttctggcagcccgtctccttggttgctaggt
cagtcagctcagaaaatccggtctggcccatcagtttctgctagagcttcttccattgtg
gaaaaagagattgtatttcgttcaggcggatgtggatttgtccagaacttcagtcatata
actcctggaagctggattaattcaaagcctatgagggtggtcattcatccagaggcaact
gttcgaacttgggggcgtctattttcttcagaaagtggagacacggttgatgttgtggtt
cctcctttggctgaatctatctctgatggaactctggcacaatttttgaagaggcctggt
gacagggttaatgctgacgagcctattgctcaaattgaaacagataaggtgacaattgat
gtttcaagtcctgagtcaggcgtgattctaaagcttctagccaacgaaggtgatactgtt
gagccaggtaacaagatagcaatcatttcaaggtctgctgatgcaactcacgttgcccca
tctgagactatatctgagaaagctgctcctcagccaacccaaaaggttagcgaggagaag
aaagccccgaaagttgaaactgctcctgctaaagagaagcccaaaacacctcctgccact
ctgaagtctcccactgagccccagcttcctcctaaagaaagagaaagacgagttcctatg
acaaggcttcggaaacgagttgctacacggctgaaagattcccaaaacacatttgctatg
ctgactaccttcaatgaagttgatatgactaatttgatgaagctccgttctgattataag
gatgcttttgttgaaaagcatggagtcaaattggggcttatgtctggctttgtcaaagct
gctgtcaatgcactccaacatcagccgattgtcaatgcagtcattgatggtgatgatatt
atatacagagattatatagatatcagcatagctgttggtactccaaagggccttgttgta
ccggttatccgcaatgctgataccatgaactttgctgatatagaaaagcagattaatact
tttgcaaagaaggcaaatgatggatctttatcaattgatgagatggctggaggcactctt
acaatatccaatggtggtgtttatggaagccttttgagtacccctattatcaaccctcct
cagtctgcaatcttgggtatgcattccatagtgagccgtccaacggttgttggaggaaat
attgtcccaagaccaatgatgtacgtggctctaacatatgaccacagaattattgatgga
agagaggccgtgttctttctgcgacgcatcaaagatattgtggaggatcctcgcaggctt
ctgcttgacatatga

DBGET integrated database retrieval system