KEGG   Glycine max (soybean): 100799515Help
Entry
100799515         CDS       T01710                                 

Definition
ethanolamine kinase 2-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100799515
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100799515
    2.7.1.82  ethanolamine kinase
     100799515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 362 aa AA seqDB search
MAIKTMELLKGCGSQEEIMEVLSAVASDLGDVIDDVNTLQVIPLNGALTNEVFQINWPTK
NDGEVRKVLIRLYGEGVEVFFDREEEIRTFECISKHGQGPRLLGRFTSGRVEEFIHARTL
SAADLRDPEVSALIASKMREFHNLHMPGAKKAQIWHRVRKWLGQAKSLCSPKDAKKFGLD
NLDEEINILEKKLSEGYQEIVFCHNDLQYGNIMMDEETRLITIIDYEYAGYNPIAYDLAN
HFCEMVADYHSDTPHVLDYKKYPGLEERQRFIRNYLSSEDNKPSNAKVNQLVKAAEKYTL
ANHLFWGLWGLISSYVNKIDFDYKEYGRQRFQQYWIRKPTLLDSPSIVSLDETVNGLLSS
FT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccataaagacaatggaactattgaaagggtgcggatcacaggaagagataatggaa
gtgctttctgcagtggcttcggatttgggggatgtgatcgatgatgtgaacaccttgcag
gtgattccactgaatggtgcattgaccaatgaagtttttcagataaactggccaaccaaa
aatgatggtgaggtcagaaaggttctgattcgtttatatggggaaggtgttgaagttttc
tttgacagggaagaagaaattcgaacctttgagtgcatttcaaagcatggtcagggtcca
cgccttcttggccgattcacctctggcagagttgaggagtttattcatgccagaactcta
tcagctgctgacctccgtgaccctgaagtatctgctttgatagcatctaagatgagagag
ttccataatcttcatatgcctggtgcaaagaaggctcagatttggcacagagtgaggaag
tggcttggtcaagccaaaagtctgtgctccccaaaggatgcaaaaaaatttggcttggac
aatctggatgaggaaataaatatcctggagaagaagttatctgaaggatatcaagagatt
gttttttgtcacaatgacttacaatatggtaacataatgatggatgaagagacaagatta
atcactataattgactacgaatatgccggttataatcctattgcatatgacctggccaat
catttctgtgaaatggtggcagattaccacagtgacacacctcatgttcttgactacaag
aaatatccaggactagaggaacgtcaaagatttattcgcaactatctgagttctgaagac
aataaaccaagcaatgctaaagtgaaccagttagtgaaagctgcagaaaaatacactctt
gcaaaccatctattttggggtttgtggggacttatttcgagttatgtgaacaaaattgac
tttgactataaggagtatggaaggcagaggtttcagcaatactggataaggaagcctact
ttattggactcaccaagcatcgtttccctagatgaaactgtgaatggattgctgtcatcc
ttcacgtga

DBGET integrated database retrieval system