KEGG   Glycine max (soybean): 100799656Help
Entry
100799656         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 532 aa AA seqDB search
MFLFGSFTEDETQSLLSKQSSGKKEKPVEKNQLQFGSLNSVTVESNNLLNSSKSPDNSPP
SDSQKCNGVKSVSDNSPEVSGTIKENGSITNISPRSITTSTISVNEVEEKNANSFTLRGE
DGPSNKFTKLSLDASEAESLKNLHKIGNGDDSAPKLSDREPQKAPNGHAVMHVKDILPRG
LINSGNLCFLNATMQALLSCSPFVHLLQQLRTRNLPKVGYPTLTAFAEFIAQFDMPSTTK
VKKQDTDTFESGRPFRPVMFEVVLKNFTPDVPNSISGRPRQEDAQEFLSFVMDQMHDELL
KLEGHSSSLNGSKSSLVSSVEDDEWETVGPKNKSAVTRTQSFLPSDLSGIFGGQLRSLVR
AKGNRASATVQPYLLLHLDIYPDAVHTIEDALHLFSAPETLEGYRTSLTAKAGVVTARKS
VRIVTLPKIMILHLMRFGYGSQGSIKLHKPVHFPLELVLGRELLVSPSTEGRKYELVATI
THHGTEPSKGHYTADAQYPNGRWLRFDDQSVFAIGTNKVLHDQAYVLFYRQM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtttctatttgggtcatttactgaagatgaaactcaatcattgctgtcaaagcagtct
tctggaaaaaaggaaaaacctgtggagaagaatcagctgcaatttggttctctgaattct
gttactgttgagtcaaacaacctgctaaattcatcgaaatcaccagataattctccaccc
tctgattctcagaaatgtaatggagtgaagagtgtcagtgataattcacctgaagtgtca
ggaacaattaaagagaatggcagcattaccaatatctcccctaggtccatcaccaccagt
accatcagtgtaaatgaagttgaagaaaaaaatgcaaattcttttacattacgtggtgaa
gatggtccctcaaacaagtttacaaagttgagcctagatgcttctgaggctgaaagcttg
aagaatttacataaaattggtaatggggatgattctgcaccgaagttatctgatcgagaa
ccccaaaaggcacctaatgggcatgctgttatgcatgttaaggatatactgcctcgaggc
cttatcaactctgggaatctatgttttcttaatgcaaccatgcaggctctcttgtcatgc
tcacctttcgttcatcttttacagcaattaagaactcgcaaccttcctaaggttgggtat
cccacattgacggcatttgctgagttcatagcccaatttgatatgccaagcacaactaaa
gtaaagaagcaagatacagatacgtttgagtctggaaggccatttcgccctgttatgttt
gaagttgtcctaaagaattttactccggatgtgccaaatagcatttcaggaagaccaaga
caggaagatgctcaggaatttctgagctttgtaatggatcaaatgcatgatgaattactg
aagcttgaaggacactcttcaagtcttaacggcagcaaatcttctctggtttcttcggtg
gaagatgatgaatgggaaacagtggggccgaagaataaatctgctgtgacaaggactcaa
agctttctcccatcggatttaagtggtatttttggaggacaacttagaagtttggtgaga
gctaaaggaaatagagcttctgctactgttcaaccatatctcttgctccatcttgacatc
tatcctgatgctgttcacacaattgaggatgcacttcacttgttttctgcaccagagact
cttgaagggtaccgaacatcactcactgcaaaggccggtgttgtgactgcaaggaaatct
gttcgaatagtgacactcccgaaaataatgatattgcacctgatgcgttttggttatgga
agccagggaagcatcaagttgcataagcctgtccactttcctcttgagttggtattgggt
cgtgaattgcttgtttcaccatctactgagggtcgaaagtatgaacttgttgctacaatt
actcaccatggaacggagccttcaaaggggcactacacagctgatgcccaatatcccaat
ggtcgatggctacgatttgatgaccaatctgtctttgctattggaacaaataaggtgctg
catgatcaggcatatgtgcttttctacagacagatgtga

DBGET integrated database retrieval system