KEGG   Glycine max (soybean): 100799911Help
Entry
100799911         CDS       T01710                                 

Definition
endoglucanase 24-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100799911
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100799911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 491 aa AA seqDB search
MAPPNFRAYSIILILLFVNSGSAHNYQEALSKAILFFEGQRSGFLPQDQRQNWRANSGLG
DGWTYNVDLTGGYYDAGDNIKFGFPMAFTTTMLSWSVIEFGDMMPPNEHRNALVAIRWAT
DYLLKTVSQPNRIFVQVGDPISDHNCWERPEDMDTSRTVYAVDAPNPASDVAGETAAALA
AASMAFRSSDPGYSDTLLRNAAKAFQFADTYRGAYSDNADVRSGVCPYYCDFDGYQDELL
WGAAWLRRATQDENFLNYIQSNGKTLGAEDNINEFGWDNKHAGLNVLVSKEVLDGNVMSL
ESYKTSAESFLCTLIPETSSSHIEYTPGGLIYRPGGSNLQHATSIAFLELVYANYLSRTS
QTINCGNIYVNAQTLRQHAKKQVDYILGDNPMRMSYMVGYSNKYPQHIHHRGSSLPSIKD
HPQFIACKEGSIYFNSSNPNPNVLVGAIVGGPGEDDVYEDDRADFRKSEPTTYINAPFVG
ILAYFVANPNP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcccaatttcagagcctattctattattcttattcttcttttcgtcaattca
ggaagcgcccacaattaccaggaggcattgtccaaggcaatcctattcttcgagggccaa
cgttcgggtttcttgccgcaagaccagagacagaactggcgcgccaattcgggcctcggc
gacggctggacctacaacgtcgacctcaccggcggctactacgacgccggcgacaacatc
aaattcgggtttccgatggcattcaccaccacaatgctgtcctggagcgtcatcgaattc
ggagacatgatgcctcccaacgagcaccggaacgccttggtcgcaatccgttgggcaacc
gattatttgctcaaaactgtttctcagccaaaccgcattttcgttcaggtgggtgatcca
atctctgaccacaattgttgggaaaggcctgaggacatggacacaagcaggacagtgtat
gctgttgatgcaccaaacccagcttcagatgtagctggtgaaactgctgcggcactagct
gctgcatcaatggcttttcgttcatcggatcctggttattcagacactttgcttcgaaat
gctgctaaggcctttcaatttgcagatacctataggggtgcctacagtgacaatgctgat
gttaggagtggtgtttgcccatattattgtgacttcgatggttatcaggacgaattgtta
tggggagccgcatggctaaggagggccactcaggatgaaaatttcctcaactacattcaa
agcaatggtaaaacccttggtgctgaagacaatataaatgagtttggttgggacaacaaa
catgctggccttaatgttcttgtctccaaggaagttctagatggaaacgtaatgtctctt
gaatcctacaagacttcagcagagagctttctgtgcacactcatacccgaaacatcaagt
tcacatatagagtacactcccggtggactcatatacaggcctgggggcagcaacttgcaa
catgcaacttcaattgctttccttgaattggtttacgccaattacctatctcgcacttcg
caaaccataaattgtgggaacatctatgttaacgcacaaacacttcgccagcatgctaag
aagcaagttgattacattttgggagataacccaatgcgtatgtcctacatggttggctac
agcaacaagtatccgcaacatattcaccatcgtggctcctctttaccctctattaaggac
catcctcagttcattgcctgcaaagaaggctcaatctacttcaactcaagcaatcctaat
cctaatgttctcgtgggagccattgtgggaggacccggagaagatgatgtgtatgaggat
gatagggctgattttaggaagtccgaaccaaccacatacattaatgcaccatttgttggg
attttagcatactttgttgccaatcccaacccttga

DBGET integrated database retrieval system