KEGG   Glycine max (soybean): 100800194Help
Entry
100800194         CDS       T01710                                 

Definition
pectinesterase/pectinesterase inhibitor-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gmx00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gmx00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 579 aa AA seqDB search
MKNGLDTTHEKKKRKLAILSVSSLLLVAMVVAAAVGIREGADVVEEGGDSIVKSQRNVQV
ICESAEYKETCHKSLAKASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMNKQ
AMDICKEVLGYAVDDMHQSVRKLEEFELNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTT
NEAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLSEVDGFPTWVS
EGQRRLLQAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYVKAGVYQEYIMIN
KHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFGVNAANFMAMNIGFENTAGAEKHQ
AVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFI
VRKPMENQQCMVTAGGRTKIDSPSALVFQSCIFTGEPDVFALSPKIAYLGRPWRVYAKVV
IMDSQIDDIFVPEGYMPWMGSAFKDTSTYYEFNNRGFGANTQGRITWPGFKVITPIEATD
YYPGKFFEIANSTERDSWIVGSGVPYSLGPIIALPLPTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatggactcgacaccacccatgagaagaagaagaggaagctcgccattctgagc
gtgtcttccctcctcctggtggcgatggtggtcgcggcggccgtcggcataagagaaggc
gccgatgtggtcgaggaaggcggcgactcgatcgtgaaatctcaaaggaacgtgcaagtg
atatgcgaatccgcggaatacaaagaaacatgccacaagagtctcgccaaagcttccgaa
acttccgatctgaaggagctcatcataaccgcgttcaacgccacggccgaagagatcgca
aagcaaataaaaaactcgacgctctaccacgaacttgccaccgacgacatgaacaaacag
gccatggacatctgcaaggaagttctaggttacgctgtcgatgacatgcaccaatccgtt
cgcaagttggaagagtttgaactaaacaagttgaacgattacgcctatgatctcaaggtc
tggatcgccggtactctcgctcaccaacagacatgtttggatgggttcgagaacacgacc
aacgaggctggcaagaccatggctagggttctcaacacttctttggagctcagcaacaac
gcattggacatagtgaacggtgtatcgaatctcttcaagggtcttaacttgagttccttc
agcaacaacaacaacaggaagcttctatcggaggtagatgggttccctacgtgggtgagt
gaaggacagaggaggcttcttcaggctgcggacgccaaagcggacgttgttgtggctcag
gatgggagtggacaggtgaagacaattcacgaggctcttaaattggtgcctaaaaagaac
aagaagccttttgtcatttacgtcaaggccggtgtctaccaggagtatattatgatcaac
aagcacttgacccatgtcaccatgatcggagatggccccaccaagaccagaatcaccggc
agcaaaaactacgtcgatggcatcaaaacttacaacaccgctaccttcggtgtgaacgct
gctaacttcatggcgatgaacatcgggttcgagaacacagcaggagctgagaagcaccaa
gccgttgccctgagggtaacagcagacaaggctgtattctacaactgcaacatggatggg
ttccaggacaccctctacacacaatcccagcgtcagttctaccgcgactgcaccgtcacg
ggcaccatcgacttcgtgttcggcgacgccgtggccgtgttccagaactgcaagttcatc
gtaaggaagcccatggagaaccagcaatgcatggtcaccgccggtggaaggaccaagatc
gacagccccagtgcactggtcttccagagctgcatcttcaccggcgaacccgacgtgttt
gccttgtcccccaagattgcttacttgggaaggccgtggagggtttacgctaaggttgtc
atcatggactcgcaaatcgatgacatctttgtccctgaagggtacatgccgtggatggga
agtgctttcaaggacacaagcacctactacgagttcaacaacaggggttttggtgctaac
actcaaggtagaatcacgtggcctggttttaaggttatcactcccattgaagctactgat
tactacccaggaaaattctttgagatcgctaattcgactgagcgtgattcttggatcgtt
gggtctggggtgccctactcccttggcccaattattgcgctgcctttgccaacagcttaa

DBGET integrated database retrieval system