KEGG   Glycine max (soybean): 100800255Help
Entry
100800255         CDS       T01710                                 

Definition
histone H2B.2-like
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 226 aa AA seqDB search
MAHPLSRTCHSLLTPRIYLVPRNLTLGATRQPLESPEDTQTTEEEEVGSQEHVVIIPIQE
VIPQAQKVSPNSDITTENKAEQENNTHQDGGVQNQEEEQKGVVNEEAKEEKNKSKTAKEQ
NGKEKKRGRKKRNIEGYQRYVYGVLKQVHPEMGISSKCMTALNNLMNDMFERLTFEVSKL
TDYTGHMTLSSREIQGVVRLVLPGELEKHAIAEGVKAVNNYTSYDA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcctctctccagaacttgccattcacttttaaccccacgtatttacttggtt
cctaggaatttgacacttggtgccacacgtcaacctctagaatcccctgaagatactcaa
acaactgaggaagaagaagtaggtagccaagagcatgtggtgatcattcccattcaagaa
gtgattcctcaagcacagaaggtttcacctaattctgacatcaccactgaaaacaaagct
gagcaagagaataatactcatcaagatggtggagtccaaaatcaagaggaagagcaaaag
ggagtagtgaatgaggaagccaaagaggagaagaataagagtaagaccgcaaaagagcaa
aatggaaaggagaaaaaaagagggagaaaaaagagaaatattgaagggtaccagaggtat
gtgtatggggtgttgaagcaagtgcaccctgaaatgggaatttcttccaagtgcatgact
gctctgaacaacttgatgaatgacatgtttgagaggctgacttttgaggtttctaagctg
acggactacactggacacatgacattgtcttcaagggagattcaaggagtagtgaggctg
gttctcccaggagagcttgaaaagcatgctattgctgaaggggtcaaagctgttaacaac
tacacatcctatgatgcatga

DBGET integrated database retrieval system