KEGG   Glycine max (soybean): 100800640Help
Entry
100800640         CDS       T01710                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100800640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 707 aa AA seqDB search
MQDSGSMKISPLDLMSAIIKGKLDPSNVSSSSSNAAAAVLLENRQFLMLLTTSVAVLVGC
FVVFIWRRSSSPKAKPLEPPKRVIEKLPEIEVDDGTKKVTIFFGTQTGTAEGFAKAIAEE
AKARYDKATFRVVDMDDYAADDDEYEERFKKETHALFFLATYGDGEPTDNAARFYKWFTE
GGEKGEGWLENLHYGVFGLGNRQYEHFNKVAKVVDDMLAEQGGKRLVPVGLGDDDQCIED
DFTAWKEELWPALDDLLRDEDDTTVSTPYTAAVLEYRVVIHDPLEASVDEKKWHNVNGHA
IVDAQHPVRANVAVRKELHTPASDRSCTHLEFDISGTGVTYETGDHVGVYCENLSETVEE
AIRLIGLSPDTYFSIHTDDEDGKPLGGSSLPPTFPPCTLRKALAQYADVLSSPKKSALLA
LAAHASDPSEADRLRHLASPAGKDEYSEWVITSQRSLLEVMAEFPSAKPPIGVFFAAVAP
RLQPRFYSISSSPRMVPNRIHVTCALVHDKMPTGRIHKGVCSTWMKNSVPLEKSQDCSWA
PIFVRTSNFRLPADNKVPIIMIGPGTGLAPFRGFLQERLALKGGGAELGPSVLFFGCRNR
QMDYIYEDELNHFVNTGALSELILAFSREGPTKEYVQHKMMEKASEIWSMISQGAYIYVC
GDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactccggctccatgaagatctcccctctggatctcatgtccgccatcatcaag
ggcaagctcgacccctccaacgtctcctcctcctcctccaacgccgcagctgccgtcctc
ctcgagaaccgccagttcctcatgctcctcaccacctccgtcgccgtcctcgtcggctgc
ttcgtcgtcttcatctggcggagatcctcctcccccaaggccaagcctctcgaaccacca
aagcgcgttatcgagaagcttcccgaaatcgaggtcgacgacggcaccaagaaggtcacc
atcttcttcggcactcaaaccggcaccgccgaaggcttcgccaaggccatagcggaagag
gccaaggcgcgatacgataaggccacgttcagagtagtcgatatggatgattatgctgcc
gatgacgatgaatacgaggaaaggttcaaaaaggagactcacgctcttttctttttagct
acatatggtgatggtgagccaactgataatgcagcgagattttataaatggtttacggag
gggggtgagaaaggagaaggatggcttgagaatcttcactatggtgtgtttggccttgga
aacaggcaatatgagcattttaacaaggtggcgaaggtagtggatgacatgcttgctgag
caaggggggaagcgtcttgtgccagtgggcctaggagatgatgatcaatgcattgaggat
gactttactgcatggaaagaagaactctggccagcattggatgacttgcttagagatgag
gacgatacaactgtgtctacaccatatactgctgctgttttagagtaccgggttgttatt
catgatccattggaagcttctgtcgacgaaaagaagtggcataatgtaaatggtcatgcc
attgtggatgctcaacatccagttagggcaaatgtggctgtgagaaaggagcttcatact
cctgcatctgatcgatcttgcactcatttggaatttgacatttcaggcacgggagttaca
tatgaaaccggggaccatgttggtgtttactgtgagaatttgtctgaaactgtggaagag
gcgataaggttaataggtttgtcaccagatacctatttctcaatccatactgatgatgag
gatggaaaaccacttggtggaagctccttgccacctacattcccaccctgtactctaaga
aaagcacttgcacaatatgcggatgttttgagttcacccaaaaagtctgccttgcttgcc
ttagctgctcatgcatctgatccatctgaagctgatcgactaagacatcttgcctcacct
gctggaaaggatgaatattcagaatgggtgattacctctcagagaagtctccttgaggtc
atggctgaatttccatcagccaaacctccaattggtgtcttttttgcagcagttgctcct
cgcctgcagcctagattttattcaatctcctcatctccaagaatggtgccaaacagaatt
catgttacctgtgcattagtacatgataaaatgcccactggaaggattcacaagggagtg
tgttcaacatggatgaagaattctgtgccattggagaaaagccaggactgcagttgggct
cctatttttgttaggacgtccaactttagactccctgctgataataaagtgcctataatc
atgattggtccaggcactggattagctcctttcaggggtttcttgcaggaaagattagct
ctgaaaggagggggagctgaacttggcccttcagttttattctttggatgcaggaaccgt
caaatggactacatctatgaagacgagttgaatcacttcgttaatactggtgcactttct
gagctcattcttgccttctctcgagagggacccaccaaggagtatgtacaacataaaatg
atggagaaggcttcagaaatttggagcatgatatctcaaggagcttacatttatgtgtgt
ggtgatgccaagggcatggccagggatgtacaccgtgccctgcacacaattttgcaagag
cagggttctctcgatagttccaaggctgagagcatggtaaagaatctacaaactactggc
agatatttgcgcgatgtatggtga

DBGET integrated database retrieval system