KEGG   Glycine max (soybean): 100800726Help
Entry
100800726         CDS       T01710                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100800726
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C86
   100800726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 183 aa AA seqDB search
MATENSQVYHERQRLQFCLVHALNSLFQQKDAFTRAKLNAISERLTLEDSNSETWTPLSV
LFKPHHNVLTGNYDINVLIAALEEKGKTVVWHDRRKGASSIDVDAPEDVLMGFVINVAVT
RFAGIWRSRHWIALRKIDGVWYNLDSDLTAPQPFFDTDKVREFLDSTLAHGGEVLIVMNE
KQS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagagaattctcaagtttatcacgaaaggcaaaggttacagttctgtctcgtg
catgctctcaactccctctttcagcaaaaggacgctttcactcgagcaaaattgaatgca
atttccgaaagactcacacttgaagactccaacagtgaaacgtggaccccactatctgtt
cttttcaagccccatcacaatgtgttgaccggaaactatgatataaatgttctaattgct
gctttggaagagaagggaaagactgtggtgtggcatgatcgtagaaagggggcatcttcc
attgatgttgatgcacctgaggatgttttgatggggtttgtgatcaatgtggcagtgaca
aggtttgctgggatttggagaagtaggcactggattgcattgaggaagattgatggggtt
tggtataacttggacagtgaccttactgcccctcaacctttttttgatactgataaagtt
agggagttcttggattcaaccttggcccatggtggggaggttttgattgtcatgaatgag
aaacagtcttga

DBGET integrated database retrieval system