KEGG   Glycine max (soybean): 100801148Help
Entry
100801148         CDS       T01710                                 

Gene name
ANS
Definition
(RefSeq) leucoanthocyanidin dioxygenase-like
  KO
K05277  leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00941  Flavonoid biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100801148 (ANS)
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  anthocyanidin synthase
     100801148 (ANS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Motif
Other DBs
NCBI-GeneID: 100801148
NCBI-ProteinID: NP_001240884
UniProt: Q2TUW0
Position
11
AA seq 352 aa AA seqDB search
MGTVAPRVESLASSGIKCIPKEYVRPEKELKSIGNVFEEEKKEGPEVPTIDLREIDSEDE
VVRGKCRQKLKKAAEEWGVMNLVNHGIQDELIERVKKAGEEFFGLAVEEKEKYANDQESG
KIQGYGSKLANNASGQLEWEDYFFHLVFPEDKRDLSIWPKKPDDYIEVTSEYAKRLRGLA
TKMLEALSIGLGLEGGRLEKEVGGMEELLLQLKINYYPICPQPELALGVEAHTDVSSLTF
LLHNMVPGLQLFYQGQWFTAKCVPNSILMHIGDTIEILSNGKYKSILHRGLVNKEKVRIS
WAMFCEPPKEKIILQPLPELVTETEPARFPPRTFAQHIHHKLFRKDQEGLPN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggtacggtggctcccagagttgaaagcttggcgagcagtgggataaagtgtatcccg
aaggaatacgtgaggcctgaaaaagagttgaagagcatagggaacgtgttcgaggaggaa
aagaaggaagggccagaggttcccacaattgacttgagagagatagattcggaggacgag
gttgtccgaggcaagtgtcgccagaagctgaagaaagcggcggaggaatggggtgtgatg
aacttggtgaaccatgggatccaggatgagctgatagagcgagtgaagaaagcaggggaa
gagttctttggtctggcggttgaggaaaaggagaagtacgccaatgatcaggagtctggt
aagattcaaggctatggaagcaagctggccaacaatgccagtggccaactcgagtgggaa
gactacttcttccaccttgttttccctgaggacaagcgtgacctctccatctggcccaag
aaacccgatgattatattgaggttacaagcgagtatgcaaagagactgagggggcttgcc
accaagatgttggaggccctctctattggattgggtctggaaggagggaggttggagaag
gaagttggtgggatggaagagcttctacttcaattgaagatcaactactaccctatttgt
ccccagccagaacttgctcttggagttgaagcccacaccgatgtcagttcactcactttc
ctccttcataacatggtgccaggtctgcagctattctaccaaggccaatggttcacagca
aaatgtgtccccaattccattctcatgcacattggtgacaccattgagatcctgagcaac
ggcaagtacaagagcattcttcatcggggtttggtcaacaaggaaaaggttagaatatcg
tgggcaatgttctgtgaaccccccaaggagaagatcatcctgcagccacttcccgagctt
gtcactgagacagagccagcacgctttccacctcgcacttttgctcagcatattcaccac
aaactattcaggaaggatcaggaaggtctcccaaattga

DBGET integrated database retrieval system