KEGG   Glycine max (soybean): 100801148Help
Entry
100801148         CDS       T01710                                 

Gene name
ANS
Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
gmx  Glycine max (soybean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:gmx00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 352 aa AA seqDB search
MGTVAPRVESLASSGIKCIPKEYVRPEKELKSIGNVFEEEKKEGPEVPTIDLREIDSEDE
VVRGKCRQKLKKAAEEWGVMNLVNHGIQDELIERVKKAGEEFFGLAVEEKEKYANDQESG
KIQGYGSKLANNASGQLEWEDYFFHLVFPEDKRDLSIWPKKPDDYIEVTSEYAKRLRGLA
TKMLEALSIGLGLEGGRLEKEVGGMEELLLQLKINYYPICPQPELALGVEAHTDVSSLTF
LLHNMVPGLQLFYQGQWFTAKCVPNSILMHIGDTIEILSNGKYKSILHRGLVNKEKVRIS
WAMFCEPPKEKIILQPLPELVTETEPARFPPRTFAQHIHHKLFRKDQEGLPN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggtacggtggctcccagagttgaaagcttggcgagcagtgggataaagtgtatcccg
aaggaatacgtgaggcctgaaaaagagttgaagagcatagggaacgtgttcgaggaggaa
aagaaggaagggccagaggttcccacaattgacttgagagagatagattcggaggacgag
gttgtccgaggcaagtgtcgccagaagctgaagaaagcggcggaggaatggggtgtgatg
aacttggtgaaccatgggatccaggatgagctgatagagcgagtgaagaaagcaggggaa
gagttctttggtctggcggttgaggaaaaggagaagtacgccaatgatcaggagtctggt
aagattcaaggctatggaagcaagctggccaacaatgccagtggccaactcgagtgggaa
gactacttcttccaccttgttttccctgaggacaagcgtgacctctccatctggcccaag
aaacccgatgattatattgaggttacaagcgagtatgcaaagagactgagggggcttgcc
accaagatgttggaggccctctctattggattgggtctggaaggagggaggttggagaag
gaagttggtgggatggaagagcttctacttcaattgaagatcaactactaccctatttgt
ccccagccagaacttgctcttggagttgaagcccacaccgatgtcagttcactcactttc
ctccttcataacatggtgccaggtctgcagctattctaccaaggccaatggttcacagca
aaatgtgtccccaattccattctcatgcacattggtgacaccattgagatcctgagcaac
ggcaagtacaagagcattcttcatcggggtttggtcaacaaggaaaaggttagaatatcg
tgggcaatgttctgtgaaccccccaaggagaagatcatcctgcagccacttcccgagctt
gtcactgagacagagccagcacgctttccacctcgcacttttgctcagcatattcaccac
aaactattcaggaaggatcaggaaggtctcccaaattga

DBGET integrated database retrieval system