KEGG   Glycine max (soybean): 100801288Help
Entry
100801288         CDS       T01710                                 

Definition
(RefSeq) tryptophan synthase beta chain 1-like
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00260  Glycine, serine and threonine metabolism
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100801288
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100801288
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100801288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 100801288
NCBI-ProteinID: XP_003551899
UniProt: I1N0T6
Position
18
AA seq 471 aa AA seqDB search
MAASIPFTGLNSSRVLPIPKEPYHPFSHFPSSMPKFASLRIPSSSVSCSLTRDSSSVVPL
EEHDKMGNGSVLLQRPDSFGRFGKFGGKYVPETLMHALSQLEAAFYSLAADEEFQTELAG
ILKDYVGRESPLYFAERLTEHYKRPNGEGPHIYLKREDLNHTGAHKINNAVAQALLAKRL
GKKRIIAETGAGQHGVATATVCARFGLECIIYMGAQDMERQALNVFRMRLLGAEVRPVHS
GTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVREFHAVIGKETRKQALEKWG
GKPDVLIACVGGGSNAIGLFNEFVDDKDVRLIGVEAAGFGLDSGKHAATLTKGEVGVLHG
AMSYLLQDDDGQIVEPHSISAGLDYPGVGPEHSFLKDLGRAEYHSITDEEALEAFKRVSR
LEGIIPALETSHALAYLEKVCPTLANGAKVVVNFSGRGDKDVQTAIKYLKL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcaataccattcacaggtctcaactcctcaagggtgcttcccattcccaaa
gagccataccacccattttcccatttcccctcaagcatgccaaagtttgcatctttgaga
atcccttcttcttctgtgtcttgctctctcacaagagactcttcctctgttgtgccattg
gaggaacatgacaaaatgggtaatgggtcggttctgcttcagagacccgattcgtttggg
aggtttggcaagtttggagggaagtatgtccctgagactctgatgcatgctctctctcag
cttgaggctgccttttattccctcgctgctgatgaagagtttcagacagaactggctggg
attctaaaagattatgttggccgggagagtcctctttattttgctgaaaggttgacggag
cattacaagaggcctaatggtgaaggacctcacatttatctgaagagggaagatctcaat
cacactggggctcacaaaattaataatgctgttgctcaagctttgcttgctaagagattg
ggcaaaaaacgcattattgctgaaactggagcgggtcagcatggagttgccactgctact
gtatgtgctcgatttggtttagaatgcattatttatatgggtgcgcaggatatggaaagg
caggctctcaatgttttcagaatgcgtcttctcggtgctgaggtgagaccagtccattct
gggactgctacacttaaggatgcgacatcagaggctataagggactgggtgactaatgtg
gagacaactcattatattttggggtctgttgctgggccgcatccatatccaatgatggta
agagagtttcatgctgtgattggcaaggagaccagaaagcaagctttggagaagtgggga
gggaaaccagatgtcttgattgcatgtgttggtggaggttcaaatgccataggacttttc
aatgaatttgttgatgacaaagatgtaaggctaattggtgtggaggctgctggatttggc
ctggacagcggcaagcatgctgcaaccttaacaaaaggagaagttggggttttgcatgga
gctatgagctatctgctgcaggatgatgatggacaaatagttgagcctcactctattagt
gcaggcttggactaccctggtgtgggtccggaacatagctttttgaaagatttagggcgt
gctgaatatcatagtatcacagatgaagaagcattggaagcttttaagagagtttcgcga
cttgaaggcataattcctgcactggaaacatctcatgcattggcatatctagagaaagtg
tgtccaacccttgctaatggagccaaggttgtggttaacttcagtggccggggtgataag
gatgttcaaactgctatcaagtacttgaagctttga

DBGET integrated database retrieval system