KEGG   Glycine max (soybean): 100801418Help
Entry
100801418         CDS       T01710                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gmx  Glycine max (soybean)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100801418
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100801418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 363 aa AA seqDB search
MSIGTTLSTTPNHSFHSNTRTSLLNTVSPIQFLSFRNHTHNLRVLCFSSNPSQQLPPVVV
VGSANADIYVEIDRLPREGETLAAKSGQTLAGGKGANQATCSAMLSYPTYFVGQVGDDAY
GTLLSDALRGGGVRLDSLTVVASAPTGHAVVMLQSNGQNSIIIIGGANMSCWPSTLPRQH
LDLVAQAGIVLLQREIPDAVNVQVAQAARNAGVPVVMDAGGMDGPIPPQLLKFVDILSPN
ETELARLTGRPTGSFEEIAQAALKCHELGVKQVLVKLGEKGSALFVEGEKPIQQPAILAK
TVVDTTGAGDTFTAAFAVALVEGKSKKECLRFAAAAACLCVQVKGASPSMPDRKSVLDLL
NCQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcggaacaacactttcaacaacaccaaaccactctttccactccaacacccga
accagtttactcaacaccgtttccccaatccaattcctctccttccgcaatcacactcac
aatctcagagtcctctgtttctcttcgaatccgtcgcagcagctgccgccggttgtggtg
gttggctccgcgaacgccgacatctacgtggagatcgaccgtctcccacgcgaaggcgag
actctcgcggcgaagtccggccagaccctcgccggcggcaagggcgccaaccaggccacg
tgctccgccatgctctcctacccgacctacttcgtcgggcaggtcggcgacgacgcctac
ggcacccttctctccgacgcgctccgtggcggtggtgttcgcctcgatagcctcaccgtg
gtggcgtcggctcccacgggtcacgccgtcgtcatgctccaatccaacggccagaactcc
atcatcatcattggcggcgccaacatgagctgctggcccagcaccttgccacgtcagcat
ttggaccttgtggcccaagctggcattgttttgctgcagagggagatccctgatgctgtc
aacgttcaagtcgcacaggctgcaaggaatgctggtgtaccagtagtgatggatgctggg
ggcatggatgggccaattccgccacaattattgaaatttgttgatattttgagtcctaat
gaaactgaacttgctcgccttaccggaaggccaacaggaagttttgaagagattgcacag
gctgctttgaaatgccatgaactgggagttaaacaagttcttgtgaaacttggggaaaaa
ggatccgcgctttttgtagaaggagaaaaaccaattcagcagcctgccatacttgctaaa
acagttgtcgatacaactggtgctggtgatacttttactgctgcttttgctgtggccttg
gttgagggaaagtccaaaaaggaatgcctcagatttgctgctgctgcagcttgtctttgt
gttcaagtgaagggagcctctcccagcatgcctgataggaaatctgttttggatcttctt
aattgtcaatga

DBGET integrated database retrieval system