KEGG   Glycine max (soybean): 100801615Help
Entry
100801615         CDS       T01710                                 

Definition
cell division cycle protein 27 homolog B-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
gmx  Glycine max (soybean)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:gmx04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 756 aa AA seqDB search
MEAILVDCVQKSLRHFMHSNAVFLCQRLCAEFPTETNLQLLAKCYLQNNQAYCTYHILKG
AQMAQSRYLFAISCFQMGLLSEAEAALCPANEPSVEVPNGAAGHYLLGLIYRYTDRRKSA
IHNFKQALSMDPLMWAAYEELCILGAAEDATAVFGEAAALCIQKQYLHCSTSSKLHSSAE
DCNIVDTRHSASEDTSPRQLKLMQSMKDIPGNHHGPSILGGTAQPINSGLSNISFYNTPS
PMAAQLSGVAPPPLCRNVQPNGQNLSSLNADTSPKSTVNSTIQAPRRKFVDEGKLRKISG
RLFSDSGPRRSSRLSSDASVNANANATAVLGNGTSNSSKYLGGSKLSTMAFRSMTVRKGQ
SWANENADEGIRNDVLDDSRLNVASTTSSSSSTMEAKSYEQETANFPIGGQIVSGSKVIS
GASEILTILRIFGEGCRLSYLYRCQDALDTYMKLPHKHYNTGWVLSQVGKVYFELVDYLE
AEQAFGLARQIMPYSLEGMDVYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAMGNCY
SLQKDHETALKNFQRAVQLNPKFAYAHTLCGHEYVALEDFENGIKCYQSALRVDARHYNA
WYGLGMVYLRQEKFEFSEHHFRMAFHINPRSSVIMSYLGTALHALKRSEEALMVMEKAIL
ADKKNPLPMYQKANILISLEKFDEALEVLEELKEHAPRESSVYALMGRIYKRRNMHERAM
LHYGISLDLKPSATDAAAIKAAIEKLHVPDEMEDNL
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatactcgtggattgcgtgcagaagagtcttcggcatttcatgcactccaac
gccgtcttcctctgccagcgtctctgcgccgagttccccaccgagacaaatctccaattg
ttggctaaatgttacttgcagaataatcaagcttattgtacgtatcatatcttaaaggga
gcgcaaatggctcaatctcggtacttgtttgcaatatcatgctttcagatgggtcttctt
agtgaagctgaagcagcactgtgtcctgctaatgagcctagtgtagaggttccaaatggg
gcagctggtcattatctgttagggctgatttacagatacactgacagaaggaaaagtgcc
atacataattttaagcaggcactctcaatggatcctctaatgtgggctgcatatgaggag
ttgtgcatattaggtgctgctgaagatgcaactgcagtttttggtgaagcagctgctctt
tgcatacaaaaacaatacctacattgctcgacctcttctaagttgcattcatcagctgag
gattgtaatatagttgacactagacactctgcctcagaagacacaagtcctaggcaactg
aaactcatgcagagcatgaaggatattcctggaaatcatcatgggccatccattttagga
ggaactgctcaaccaattaatagtggtctgtctaacatatcattttataacaccccatct
ccaatggcagcacagttgtcaggtgttgctccaccccctttgtgtaggaatgtgcagcct
aatggccaaaatctgagctcacttaatgctgacacttctcctaagtcaacagtgaactct
accattcaagcccctcgaagaaagttcgtggatgaaggaaagttacggaagatttctgga
agattgttttctgattctggtcctcgacgtagttcaagactctctagtgatgcaagtgta
aatgcaaacgctaatgcaactgctgtattgggaaatggaaccagtaactcttctaagtat
cttggagggtcaaagctcagcactatggcatttcgttccatgacagttcgtaaagggcag
tcatgggccaatgaaaatgctgatgaagggattcgtaatgatgttttagatgattctcgt
ttaaatgtcgcatcgactacttctagttcttcttctaccatggaagctaaatcttatgag
caagaaacagcaaattttccaattggtggacaaatagtgagtggttcaaaagtcatatct
ggtgcttcagaaatactgacaattctaagaatttttggtgaaggctgtagactttcctat
ttgtataggtgccaggatgcactggatacctatatgaaacttccacataagcattacaat
actggttgggttctttcccaggtcggaaaagtgtactttgaattggttgattacttagaa
gctgagcaggcctttggccttgctcgtcagattatgccttatagtttggaaggaatggat
gtatactcaacagtcctttatcacctaaaggaagatatgaagttaagttacctggctcag
gaactgatatcaactgatcgtttagctcctcaatcttggtgtgccatgggtaattgctat
agcctgcaaaaggatcatgaaactgcactgaagaattttcaacgagctgttcaactgaat
cccaaatttgcatatgcacacaccctttgcggacatgagtatgttgcactagaagatttt
gagaatggaatcaaatgctaccagagtgcgctcagggttgatgcaaggcattataatgct
tggtatggacttggaatggtgtaccttcgccaagaaaagtttgagttctctgaacatcat
tttcgaatggctttccatatcaatccacgctcatctgttataatgtcataccttggtaca
gctttgcatgctttaaagagaagtgaggaagcgctgatggtaatggagaaggctatttta
gctgataagaaaaatccccttccaatgtatcagaaggcgaatatactcataagcttggaa
aagtttgacgaggcattggaagtcctagaggagcttaaagagcatgctcctcgcgaaagt
agtgtctatgctttgatgggcaggatctataaaaggcgtaacatgcacgagagagcaatg
cttcattatggtatttctttagatttgaaaccatctgcaacagatgctgctgctatcaag
gctgccattgagaaactgcatgtaccagatgagatggaagacaacttgtag

DBGET integrated database retrieval system