KEGG   Glycine max (soybean): 100801918Help
Entry
100801918         CDS       T01710                                 

Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00071  Fatty acid degradation
gmx00350  Tyrosine metabolism
gmx00592  alpha-Linolenic acid metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100801918
  Lipid metabolism
   00071 Fatty acid degradation
    100801918
   00592 alpha-Linolenic acid metabolism
    100801918
  Amino acid metabolism
   00350 Tyrosine metabolism
    100801918
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100801918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 CTNNBL AlaDh_PNT_C IlvN 2-Hacid_dh_C ADH_N_2
Motif
Other DBs
NCBI-GeneID: 100801918
NCBI-ProteinID: XP_003526673
UniProt: A0A0R0JL19
Position
6
AA seq 381 aa AA seqDB search
MSSSTVGQVIKCKAAVSWEAGKPLVIEEVEVAPPQAGEVRLKILYTSLCHTDVYFWEAKG
QTPLFPRIFGHEAGGIVESVGEGVTHLKPGDHALPVFTGECGECPHCKSEESNMCDLLRI
NTDRGVMIHDSQTRFSIKGQPIYHFVGTSTFSEYTVVHAGCVAKVNPAAPLDKICVLSCG
ICTGLGATINVAKPKPGSSVAIFGLGAVGLAAAEGARISGASRIIGVDLVSSRFEEAKKF
GVNEFVNPKDHDKPVQEVIAAMTNGGVDRAVECTGSIQAMISAFECVHDGWGVAVLVGVP
NKDDAFKTHPVNFLNERTLKGTFYGNYKPRTDLPSVVEKYMNGELELEKFITHTVPFSEI
NKAFDYMLKGESIRCIIRMGE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgagcacagttggtcaagtcatcaaatgcaaagctgcggtttcatgggaggca
gggaagccacttgtgattgaagaagtagaggtggcaccaccacaagctggtgaagtgcgt
ttgaagatcctctacacctctctttgccacactgatgtttacttctgggaagccaagggc
caaactccattgtttcctcgtatatttggtcatgaagctggagggattgtggagagcgta
ggtgagggtgtgactcatctcaaaccaggggaccatgccctcccagtgtttaccggggag
tgtggagaatgccctcattgcaagtcagaggagagcaacatgtgtgatcttctcaggatc
aacactgataggggtgtcatgatccatgacagccaaacaagattttctattaagggacaa
cctatttaccattttgttggtacctccacattcagtgaatacactgttgttcatgccgga
tgtgttgccaaagtcaaccctgctgccccacttgacaaaatttgtgttctcagttgtgga
atttgcacaggtcttggggctactatcaatgttgcaaaaccaaaacctggttcttctgtt
gccatttttggacttggagctgttggccttgctgctgctgaaggggcaaggatttctggt
gcatcaagaattattggggttgatttagtttctagcagatttgaagaagctaagaagttt
ggggtcaatgaatttgtgaacccaaaagaccatgacaagcctgtacaagaggtgattgct
gcaatgacgaatgggggtgtggatcgtgctgttgaatgtactggcagcatccaagccatg
atctcggcattcgaatgcgtccacgatggttggggtgttgctgtacttgttggagtgcca
aacaaagatgatgcattcaaaactcatccagtgaatttcttgaacgagagaactctaaag
ggtaccttctacggaaactacaaaccccgcactgatcttccttctgttgtggagaagtac
atgaatggggaattggaactggagaaattcatcactcacacagttccattctcagagatt
aacaaggcttttgattacatgctgaaaggggagtccatcagatgcatcattcgaatgggg
gagtaa

DBGET integrated database retrieval system