KEGG   Glycine max (soybean): 100802014Help
Entry
100802014         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 334 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDD
RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL
AINNSEAIRTAHNSFARPEPFVPEEQKVATRDDDVYHFISYLPVDGVLYELDGLKEGPIS
LGQCSGGQGDIEWLKIVQPVIQERIERYSQSEIRFNLLAVIKNRKELYTAELKELQKRRE
RILQQLAASKSDRLVDNSSFEALNNSLSEVNAGIEAATEKILMEEEKFKKWKTENIRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSPR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgcaccattgagtccgatcccggtgtgtttacagaacttattcagcaaatg
caagtgaaaggagtacaggttgaggaactttattcattggatcttgactctctcaacagc
cttaggcctgtttatgggttgatttttcttttcaaatggcgtccaggagaaaaggatgac
cgagtggttatcaaagatcccaaccctaacttgttttttgctagtcaggtaattaataat
gcttgtgcaacccaagcaatcttgtccattcttatgaattcaccagacattgacattggt
ccagagctgacgaaattgaaagaatttaccaagaatttccctcctgaactcaaaggtttg
gccatcaataacagtgaggccatacgtacagcccataatagctttgctaggccagaacct
tttgttcctgaagagcaaaaggttgctaccagagatgatgatgtttaccacttcataagc
tatctacctgttgatggggtactgtatgagcttgatggattaaaggagggtcccatcagc
cttggtcagtgctctggtgggcaaggtgatattgaatggttgaagatagtgcagcctgtg
atccaggaacgcattgaaaggtattcccaaagtgagataagattcaatctcctggcagtc
atcaagaacaggaaagagttgtatacagctgagctgaaggaacttcagaagaggagggag
cgcattttgcagcagctagcagcatcaaagtcagacagactggtcgacaatagcagtttt
gaggcactgaacaattctctctctgaagtgaatgctgggattgaagctgcgactgagaag
atcttgatggaggaagaaaaattcaaaaaatggaaaacagaaaatattcgcaggaaacac
aactacataccctttttgtttaactttctaaagattcttgctgagaagaagcagctgaag
cccctcattgagaaggccaagcagaaaacaagcagccctcggtga

DBGET integrated database retrieval system