KEGG   Glycine max (soybean): 100802492Help
Entry
100802492         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 27-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100802492
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100802492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 560 aa AA seqDB search
MGFKENSMNWIGVTVGGLVGIVGAILALKDAKVAIPFTLPWSFATDNSSFEKSLFVPGLQ
NLQNNCFLNVVLQALASCFCFQSFLHSVIGECGSKDLDENMPLALALATLLEELSSFSSE
RVTLSPRKMMLAMSNYIPNFNLTSQQDAAEAFLHLLCLLREEFGGCYAPKMSSLAEIFAS
NNRILTPIQSDCQSEQERWQQLFLGPFDGILGSSLTCQSCSSQISINFEHFDCLPLSPVL
SDTSTIRVGCTLVDCLKQFIVAEHVENYHCSQCWHNAAIKYLSIMEGNEVELEKLRRCSD
PEICDCRKMYNLDKLPWSNRFSHTLKQLSMARCPRILCIQLKRVYMNVFGELVKLQGHIS
FPLILDVLSFMTTRLGVKKHDIDVQSVPLNLKYNKRIFFPNHSDLQSEISTLKFSGLHGA
KKEQIKSDGVIDDGLVSSTNGQALHNDTVFPCSGSSESIHSDTHMQSIDQVDVSCNLVPQ
ETCSYQLVSVVEHFGKAGSGHYTVYRSVRVEFSEDVSDDYLNQTPMRWFCISDSQVHAVS
VEDVLSSEASLLFYERIPRN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggggtttaaagagaactccatgaattggattggcgtcacggttggtggcctcgtgggc
atagtgggtgcaatattggcactaaaagatgccaaagtggcgattccatttaccttgccc
tggtccttcgccacagacaatagtagcttcgagaaatcgctctttgttcccggcttgcaa
aacctccaaaacaattgcttcctcaacgttgttttgcaggctctagccagctgtttttgc
tttcagagttttcttcacagtgtgattggagagtgcgggagtaaggacctggatgaaaac
atgcctcttgcgcttgctttggctactttgctagaagagctgagttcatttagttcagaa
agggttacactgagtcctcgaaagatgatgcttgccatgtccaactacattccaaatttt
aatctaactagccagcaggatgcagctgaagcatttctccatctgttatgcttactgaga
gaagaatttggaggttgttatgctccaaagatgagttctttagcagaaatttttgcttct
aataatagaattcttactccaatacagagtgactgccaaagtgagcaggagagatggcag
caactcttccttggaccttttgatgggattcttggcagcagcttgacatgtcaaagttgt
tcatctcagatctcgattaactttgaacattttgattgtttgcctctttcacctgtgctt
agtgatacttccacaataagagttggttgtaccctggtggattgcctgaagcagttcatt
gttgctgaacatgttgaaaattatcactgcagccaatgttggcataatgccgcaatcaag
tatctttctataatggaaggaaatgaggtagaactagaaaagctaaggagatgctctgac
ccagaaatctgcgattgccgaaaaatgtataatcttgataaactaccctggtcaaacagg
ttttcacacactttgaagcagctaagtatggctaggtgtccaaggattttatgcatccag
ttgaaaagagtttatatgaatgtctttggagagctagtcaaactgcagggccatatttct
tttccattgattttggatgtgttgtcattcatgacaactagactgggagtgaagaaacac
gacatagatgtacaaagtgtgccattaaatttgaagtataacaaaagaattttttttcca
aatcattctgacctgcaatctgagataagtacattgaaatttagtggccttcatggagca
aaaaaagagcagatcaagtcagatggtgttattgatgatggacttgtctcctctacaaat
ggacaggcacttcataatgacactgtatttccctgctctggctcttcagaaagcattcac
tcagatacacatatgcaatcgattgaccaggtagatgtttcttgtaatttagtacctcaa
gaaacatgttcgtatcaacttgtttctgttgtggaacactttggaaaagctggaagtggg
cattacactgtttacagatctgtaagagtggagttttcagaagacgtctctgatgattac
ctcaatcaaactccaatgcgttggttttgtatttcagattctcaagtgcatgctgtttca
gtggaagatgttctttccagtgaggccagcttgcttttctatgagagaattccaaggaac
tga

DBGET integrated database retrieval system