KEGG   Glycine max (soybean): 100802512Help
Entry
100802512         CDS       T01710                                 

Definition
(RefSeq) replication protein A 32 kDa subunit A
  KO
K10739  
replication factor A2
Organism
gmx  Glycine max (soybean)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100802512
   03420 Nucleotide excision repair
    100802512
   03430 Mismatch repair
    100802512
   03440 Homologous recombination
    100802512
DNA replication proteins [BR:gmx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100802512
DNA repair and recombination proteins [BR:gmx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100802512
   MMR (mismatch exicision repair)
     100802512
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100802512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 277 aa AA seqDB search
MFSGSQFDATTAFSGGGFMSSQPSTLNDSSPAPSKSRETQGLVPVTVKQISEASQSGDEK
SNFVINGVDLNNVTLLGMVFEKVERNTDVNFVLDDGTGRIKCRRWVNEAFDTKEMEAVMN
GMYVRVYGHLKSFQGVKQLVTFSARPVTNFDEIPFHFIDCIHNHLRSKIKMEGITSSNPS
SGSSLNTPGKSAPNGSQAPSSNPVSAQHSVDGLKGIDKLIMDYLEQHSDMSDGRGIHVDE
LSRELKLPMEKIKLSLKTLADDGEIYSTIDDDHYKKA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggctcccagttcgacgccaccaccgccttctccggcggcggtttcatgtct
tctcagccgtctaccctcaacgattcctctcccgcgccgtcaaaaagccgcgaaactcag
ggtttggtgccagtgacagtgaagcagataagcgaggcctctcaatccggtgatgaaaag
tcgaatttcgtgatcaacggtgtagatctgaacaatgtaacactgcttgggatggtgttt
gagaaagttgagagaaatactgatgtcaattttgttttggatgatggaacaggacgcatc
aaatgtcgaagatgggttaatgaggcttttgacacaaaggaaatggaggcagtgatgaat
ggtatgtatgttcgtgtttatgggcatttgaaaagttttcaaggtgttaagcaacttgtc
accttctccgccaggcctgtcacaaattttgatgagatcccttttcactttattgattgc
atacataaccatcttcgctccaaaataaagatggaaggaatcacttcttcaaatccttca
tctggctcatctttgaacactcctggcaaaagtgcaccaaatggatctcaggcaccatca
tcaaatccagtaagtgcacagcatagcgtggatggacttaagggtattgataaattgatt
atggactacctggagcagcattcagatatgtcagatggacgtggaatacatgttgatgaa
ctatcacgggagctcaagcttccaatggaaaagatcaagttgtcgttgaagactcttgca
gatgatggagaaatatactccaccatagatgacgaccattacaaaaaagcttga

DBGET integrated database retrieval system