KEGG   Glycine max (soybean): 100802870Help
Entry
100802870         CDS       T01710                                 

Definition
histone deacetylase 15-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 543 aa AA seqDB search
MVSGALKTTENSLHKQASQVSDANDAVADPDIPAKRARLQKEQKDLTFQDIYQNDGVFDD
EDSDWEPFQLHKCMDFEIKKWFCRNCTMVNLDHDDCCYICGEHTDSKILSHGFFASPLAQ
DENLTEVQGIAKGLKDVGSQELVANSSTAIGFDERMLLHAEVEKKSTLHPERPDRLQAIA
ASLARAGIFPGKCYSIPAREITPEELITVHSLEHIESVEVTSESLSSYFTSDTYANEHSA
LAARLAAGLCADLASAIVSERAKNGFALVRPPGHHAGVRHAMGFCLHNNAAVAALAAQAA
GARKVLILDWDVHHGNGTQEIFEQNKSVLYISLHRHEGGKFYPGTGAAEEVGSMGAEGYC
VNIPWSRGGVGDNDYIFSFQHVVLPIAAEFNPDFTIVSAGFDAARGDPLGCCDITPSGYA
HMTHMLNALSGGKLLVILEGGYNLRSISSSATAVIKVLLGESPGCELENSFPSKAGLQTV
LEVLKIQMNFWPALGPIFVTLESQWRVYCFGKKRKHIKKRHRILVPMWRWGRKFIIPFSE
RPP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggttagtggagctctcaaaacgactgagaacagtcttcacaagcaagcttctcaggtt
tccgatgccaatgatgcagttgctgaccctgatattcctgcaaagagagccaggctgcag
aaggaacagaaggatttgacctttcaggacatatatcaaaatgatggcgtgtttgacgac
gaagacagtgattgggagccgtttcagttacacaagtgtatggattttgaaatcaaaaag
tggttctgcagaaattgtaccatggttaacctcgatcacgatgactgttgctacatatgc
ggggagcatacggattctaaaatccttagccatgggttttttgcatctcctttagcccaa
gatgagaatctgactgaagtccaggggatcgctaaaggactgaaagatgttggctcacag
gaattagtggcaaatagttctacagcaatcggctttgatgagagaatgttgttacatgca
gaagttgaaaagaaatccactctgcatcctgagaggccagatcgtcttcaagcaattgct
gctagtcttgctagagctggcatatttcctggaaaatgctattcaattcctgctagagaa
atcacaccagaagaacttattacggttcattccttggagcatattgaatctgtggaagtt
acaagcgaatcactttctagttatttcacttctgacacatatgccaatgagcattcagca
cttgctgctaggttggcagctgggttatgtgctgatctagcatcagcaattgtttctgag
cgagccaaaaatggatttgctttggttaggcctcctggtcatcatgctggtgtaagacat
gcaatggggttctgccttcacaataatgctgctgtggctgcattggcagctcaagctgca
ggggctaggaaggtgctaattttggattgggatgttcatcacggaaatgggacacaagaa
atatttgaacaaaacaaatcggtcttgtatatatcattgcatagacacgagggaggaaaa
ttttatcctggtactggagctgctgaagaggttggtagtatgggtgcagaaggatactgt
gtgaatattccatggagtcgaggaggagttggtgacaatgactatattttttcatttcag
catgttgtccttcctatagctgctgagtttaatccagattttaccatagtatctgctgga
tttgatgctgcaagaggtgatcccctaggatgttgcgatattactccctctggctatgca
catatgacacatatgttgaatgccctttctggcggaaaattgcttgttattcttgagggg
ggctataatcttcgttctatatcatcttctgcaactgcagtaatcaaggtattactgggt
gagagtcctggatgtgaactggaaaatagtttcccttccaaagctggcctgcaaactgtt
ttggaagtcctcaaaattcagatgaacttttggcctgccctgggtcccatttttgtgact
ttggagtcacaatggagggtgtactgttttggaaaaaaaaggaaacatattaagaaacga
caccgaattctggttccaatgtggaggtggggacgaaagtttattattccattttctgaa
cggccaccttaa

DBGET integrated database retrieval system