KEGG   Glycine max (soybean): 100803005Help
Entry
100803005         CDS       T01710                                 

Definition
rae1-like protein At1g80670-like
Orthology
K14298  
mRNA export factor
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100803005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 347 aa AA seqDB search
MSNFLSNTNPNPNKSFEVNQPPTDSVSSLSFSPKANFLVATSWDNQVRCWEVARNGVNVA
TVPKASITHDHPVLCSTWKDDGTTVFSGGCDKQVKMWPLLSGGQPMTVAMHDAPIKELAW
IPEMNLLVTGSWDKTMKYWDTRQSNPVHTQQLPERCYAMTVRHPLMVVGTADRNLIVYNL
QNPQVEFKRIVSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHLDDSQHGKNFTFKCHRE
GNEIYSVNSLNFHPVHHTFATSGSDGAFNFWDKDSKQRLKAMLRCSQPIPCSTFNNDGSI
FAYSVCYDWSKGAENSNPAAAKTYIFLHLPQESEVKGKPRIGATGRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatttcctgagcaatactaatccgaaccctaataagtccttcgaggtgaatcag
cctcccactgattccgtgtccagtcttagcttcagtcccaaagccaacttcctcgtcgcc
acttcttgggacaatcaggttcgttgttgggaggtagcacggaatggagtaaatgttgcc
actgttcccaaggcttctataacgcacgatcatccggttttgtgctctacatggaaggat
gatggcacgactgtattctctggtggatgtgataagcaagtgaagatgtggcctctgtta
tctggaggccaaccaatgactgttgccatgcatgatgcacccatcaaagaacttgcttgg
attcctgaaatgaaccttttagtcacaggaagctgggacaagactatgaaatactgggat
acaaggcagtcaaatccagtgcacacacagcaactcccagagcgctgctatgctatgaca
gtgagacatcctctgatggttgttggcactgctgatagaaatcttattgtttacaacttg
caaaaccctcaggttgaattcaagagaattgtttcacccttgaagtatcaaacaaggtgc
cttgctgcattccctgaccaacaaggtttcttggttggatcaatagaaggaagagttggg
gtgcatcatttggacgatagtcagcatggtaaaaacttcacttttaaatgccatagagag
ggcaatgaaatatactcagtcaactctttaaacttccatcctgtacaccacacatttgca
acttctggttctgatggtgctttcaatttttgggataaggatagtaaacagaggctcaag
gccatgttgagatgcagccaacctattccttgcagtaccttcaacaatgatggttcaata
tttgcttactcagtctgctatgactggagtaaaggggcagaaaattctaatcctgcagca
gcaaaaacctatattttcctgcatttgcctcaggaatctgaggttaagggcaaaccacgc
attggtgctactggcagaaagtag

DBGET integrated database retrieval system