KEGG   Glycine max (soybean): 100803586Help
Entry
100803586         CDS       T01710                                 

Definition
NAD-dependent protein deacetylase SRT1-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100803586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 479 aa AA seqDB search
MSLGYAEKLSYIEDVGNVGMVEYFDPSHVLREKIDQLAIMIKKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKALPEASLPFHRAAPSMTHMALVELEKAGILKFVISQNVDGLH
LRSGIPREKLAELHGNSFMETCPSCGEEYFRDFEVETIGLKETSRRCSVAKCGTRLKDTV
LDWEDALPTKEMNPAEKHCKQADIVLCLGTSLQITPACNLPLKALRGGGKVVIVNLQKTP
KDKKASLVIHGFVDKVIAGVMDQLNMQISPFVRIDLFQIILVQALSNDKRYVNWTLQVAS
AHGQKAALPFIKSVEISFLDREDYKAAILDKQPFRLKRRTAYNKAFEMVLKLNFSDGCGC
SSLEIDVPVDFKVSTDCFDFDKDYIFQKLRDKAVLESRCGQNAVIERKTILTPRSDVTTY
AIVTNVVQYSKACKAALDSLSNGDFKKRKASVTGTGSSRKRSKGSSKCKSRSDNIRGHT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctctggggtatgccgagaagctttcctacatagaagatgtgggcaacgttggaatg
gtcgaatatttcgacccatcccatgttttgcgagagaaaatagatcaacttgctatcatg
ataaaaaagagtaagcatctagtggtgtttactggtgcaggaatatcaacttcttgtggt
atacctgattttcgaggtcccaagggaatttggacacttcagcgtgaaggtaaagccctg
cctgaagcatcactgccatttcatcgtgcagcgccaagcatgacacacatggctctggtt
gaattagaaaaggctggcattttgaagttcgtcatcagtcagaatgttgatggtctccat
cttcgatctggaataccaagggagaaacttgctgaattgcacgggaattccttcatggag
acatgcccttcttgtggagaagagtactttcgtgattttgaggtagaaactattggttta
aaggagacttcaaggcgttgttcagttgccaaatgtgggactagacttaaggatacagtc
cttgactgggaggatgcattgcctacaaaggagatgaatcctgctgagaagcattgcaaa
caggcagatatagtgttatgcctgggtacaagtttacaaataactccagcatgcaacttg
cctctgaaagcacttcgtggtgggggtaaagttgttattgtaaatctccagaaaactcca
aaggacaaaaaagccagtttagtcatacatgggtttgtagataaggtaattgcgggtgtc
atggaccagcttaatatgcagatttctccatttgtcaggattgatcttttccagattatt
ctagtgcaagctttgagtaacgataaaagatatgtgaactggactctccaggttgcaagt
gctcatggacaaaaagcagcattgcctttcatcaagtctgttgagatctccttcttggac
agggaagattataaagcagccattctggataagcaaccatttcggcttaaaaggagaaca
gcatataacaaagcatttgaaatggttctgaaactcaactttagcgatggctgtggttgc
tcatcccttgaaattgatgtccctgttgattttaaggtttcaactgactgctttgacttt
gataaggactacatattccaaaagctgagagacaaggcagttcttgaatcaagatgtggt
cagaatgctgttattgagagaaagaccatcttgacacctagaagtgatgtcactacctat
gccattgtgaccaatgttgttcagtacagcaaagcatgtaaagcagcccttgattctctt
agtaatggtgattttaaaaaaagaaaagctagtgtgactggtactggatcatctaggaag
cgttcaaaggggtcctccaagtgtaaatctagatcagacaatattaggggtcatacgtag

DBGET integrated database retrieval system