KEGG   Glycine max (soybean): 100803679Help
Entry
100803679         CDS       T01710                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gmx01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gmx00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:gmx00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 2260 aa AA seqDB search
MADIGRRNGYANSVLPNRPPAAISEVDEFCNALGGNRPIHSILIANNGMAAVKFIRSVRS
WAYETFGSEKAILLVAMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLILEMAEI
THVDAVWPGWGHASENPELPDALKAKGIVFLGPPAISMAALGDKIGSSLIAQAAEVPTLP
WSGSHVKIPPESSLITIPDEIYREACVYTTEEAVASCQVVGYPAMIKASWGGGGKGIRKV
HNDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRH
QKIIEEGPITVAPIETVKKLEQAARRLAISVNYVGAATVEYLYSMETGEYYFLELNPRLQ
VEHPVTEWIAEINLPAAQVAIGMGVPLWQIPEIRRFYGVEHGGGYDAWRKTSVLATPFDF
DKAQSTRPKGHCVAVRVTSEDPDDGFKPTSGKVQELNFKSKPNVWAYFSVKSGGGIHEFS
DSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLNASDYRENKIHTGWL
DSRIAMRVRAERPAWYLSVVGGALYKASASSAALVSDYVGYLEKGQIPPKHISLVHSQVS
LNIEGSKYTIDMIRGGSGSYRLRMNQSEIEAEIHTLRDGGLLMQLDGNSHVIYAEEEAAG
TRLLIDGRTCLLQNDHDPSKLVAETPCKLLRYLVADDSHVDADTPYAEVEVMKMCMPLLS
PASGIIHFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFTGSFPVLGPPTAISGKVHQKC
AASLNAARMILSGYEHNIDEVVQSLLNCLDSPELPFLQWQECLAVLATRLPKELKNELES
KYKEFEGISSSQIVDFPAKLLKGIIEAHLSSCPDKEKGAQERLVEPLLSLVKSYEGGRES
HAHIIVQSLFDEYLSVEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQGIKSKNKLI
LQLMDKLVYPNPVAYRDQLIRFSLLNHTNYSELALKASQLLEQTKLSELRSNIARSLSEL
EMFTEDGENIDTPKRKSAINDRMEDLVSAPFAVEDALVGLFDHSDHTLQRRVVESYIRRL
YQPYLVKGSARMQWHRSGLIATWEFYDEYIERKNGVEDQSLSKTVEEKHSEKKWGVMVII
KSLQFLPAIITAALREATNNPHEALTSGSVEPVNYGNMMHIGLVGINNQMSLLQDSGDED
QAQERINKLAKILKEQEVGSTIRAAGVGVISCIIQRDEGRAPMRHSFHWSEEKLYYAEEP
LLRHLEPPLSIYLELDKLKAYENIRYTPSRDRQWHLYTVVDHKPQPIQRMFLRTLVRQPT
TNEGFSSYQRLDAETSRTQLAMSFTSRSIFRSLMAAMEELELNAHNVNIKSEHAHMYLYI
IREQQIDDLVPYPKRINIEAGKEEITVEAVLEELAREIHSSVGVRMHRLGVVVWEIKLWM
AACGQANGAWRVIVNNVTGHTCTVHLYREKEDTITHKVVYSSVSVKGPLHGVAVNENYQP
LGVIDRKRLSARKNSTTYCYDFPLAFETALEQSWAIQQPGFQRAKDKNLLKVTELKFADK
EGSWGTPLVPVENYPGLNDVGMVAWFMEMCTPEFPSGRTILVVANDVTFKAGSFGPREDA
FFRAVTDLACTKKLPLIYLAANSGARLGVAEEVKSCFRVGWSEESNPENGFQYVYLTPED
NARIGSSVIAHELKLESGETRWVIDTIVGKEDGLGVENLSGSGAIAGAYSRAYKETFTLT
YVTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATN
GVVHLTVSDDLEGVSSILKWLSYIPSHVGGALPIVKPLDPPERPVEYFPENSCDPRAAIS
GTLDGNGRWLGGIFDKDSFVETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADP
GQLDSHERVVPQAGQVWFPDSATKTAQAILDFNREELPLFILANWRGFSGGQRDLFEGIL
QAGSTIVENLRTYKQPIFVYIPMMGELRGGAWVVVDSRINSDHIEMYADRTAKGNVLEPE
GMIEIKFRTRELLESMGRLDQQLITLKAKLQEAKSSRNIVAFESLQQQIKSRERQLLPVY
TQIATKFAELHDTSLRMAAKGVIREVLDWRNSRSVFYQRLHRRIGEQSLINSVRDAAGDQ
LSHASAMNLLKEWYLNSDIAKGREDAWLDDEAFFRWKDIPSNYENKLKELRVQKVLLQLT
NIGDSALDLQALPQGLAALLSKLEPLGRVKLTDELRKVLG
NT seq 6783 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattgggcgtaggaatggatatgcaaacagtgtactaccaaataggccacct
gctgcaatatctgaagtagatgaattctgcaatgcccttggtggaaacaggccaattcat
agtatattaattgcaaataatggaatggcagcagtcaagtttatacgtagtgttaggagc
tgggcctatgagacatttggctcagagaaagccatcttgttggttgccatggctactcca
gaggacatgagaatcaatgcagaacatatcagaatagctgatcaatttgtggaagtacct
ggtgggaccaataacaataactatgccaacgtgcagcttattcttgagatggctgagata
actcatgttgatgcggtgtggcctggttggggtcatgcatcagaaaatcctgagcttcca
gatgcattaaaagcaaaaggaattgtatttcttggacctcctgctatatctatggctgca
ttgggggataaaattggttcatcattgattgctcaagcagcggaagtgcctacccttcca
tggagtggttctcatgtgaaaattccgcctgaaagttccttgattactattcctgatgaa
atttatcgggaagcatgtgtttatacaacagaggaagcagtggcaagttgtcaagttgta
ggataccctgcaatgatcaaggcatcttggggtggtggtggtaaaggaataagaaaggtt
cataatgatgatgaggtaagggcattgttcaagcaagttcaaggtgaagttccgggttca
cccatatttataatgaaggttgcatcccagagccgacatctagaagtccagttactttgt
gatcagtacggaaatgtcgcagctttgcatagccgtgattgcagtgttcaaaggaggcac
caaaagattattgaggaggggcccattactgtagcacccatagaaacagtgaaaaaactg
gaacaggccgctagaaggttggctatatctgtaaattatgttggggcggctactgttgag
tatctttatagtatggaaactggcgagtactactttttagagttgaaccctcggctacag
gttgaacatcctgttactgagtggatagcagagataaatctgccagcagcacaagttgcc
attgggatgggtgttcctctctggcaaattcctgagataaggcgtttctatggggtggaa
catggtggagggtatgatgcttggagaaaaacatccgttttagctaccccttttgatttt
gacaaagcacaatctacaaggccaaaaggtcattgtgtggctgtgcgagtaactagtgag
gaccctgatgatggttttaagcctacaagtggcaaagtgcaggagcttaactttaaaagc
aagccaaatgtgtgggcgtacttctctgtcaagtctggaggaggaattcatgaattctca
gattcacagtttgggcatgtttttgcttttggagaatctagggctttagcaattgcaaat
atggttctggggctgaaggagattcagattcggggagaaatccgtaccaatgttgattac
accattgatcttctgaatgcttcagactacagagaaaacaaaattcacacaggttggctg
gacagtagaattgcaatgcgggttagagcagaaaggcctgcctggtatctttcggtcgtt
ggaggggcactctataaagcttctgctagcagtgcagctttggtttcagattatgttggt
tatcttgaaaagggacaaatccctcccaagcacatatctcttgtccattctcaagtgtcc
ttgaacattgaaggaagcaaatatacgattgacatgatacgaggtgggtctggaagttat
agattgagaatgaatcaatcagagatagaagcagaaatacatactttacgtgatggaggt
ttgctaatgcagttggatggaaacagtcatgtaatatatgcagaggaagaagcagctgga
actcgccttctaatagatggaaggacttgcttgcttcagaatgatcatgatccatcaaag
ttggttgcggagacaccatgcaagcttctgagatatttggttgcagatgacagtcatgtt
gatgctgacacaccatatgctgaagttgaggtcatgaaaatgtgcatgcctcttctttcg
cctgcttctgggattattcatttcaaaatgtctgaaggtcaagcaatgcaggctggtgaa
cttatagcaaggcttgatctggatgatccttcagctgtaagaaaggcagaacccttcact
gggagcttcccagttctgggacctcctactgcaatttctggtaaagttcatcagaaatgc
gctgcaagcttaaatgccgcacggatgattctctctgggtatgagcacaatattgatgaa
gttgtgcaaagtttgcttaattgccttgatagtcctgaattgcctttccttcaatggcaa
gagtgcttggcagttcttgcaacccgtcttcccaaagagctaaaaaatgagttggaatca
aaatataaggagtttgaggggatttcaagctcccaaattgttgatttccctgccaaatta
ttgaagggaattattgaagctcatctttcctcctgtcccgacaaagaaaaaggagctcaa
gaaagactagttgaacctctattgagtcttgttaagtcttatgagggtggaagagagagc
catgcccatataattgttcaatccctatttgatgagtatctttctgttgaagaattattt
agcgataatattcaggctgatgtgattgaacgtctgcgtctacaatacaagaaagatcta
ttgaagattgttgatatagtgctctctcatcagggaatcaagagtaaaaataagctgatc
ttgcaactgatggataaattggtttaccctaaccctgttgcctatagggatcagttaatc
cgtttctctttactcaaccatacaaattattctgagttggctctaaaggcaagtcaactg
ctggaacaaactaaattaagtgaacttcgatccaacattgctagaagtctttccgaatta
gagatgttcacagaggatggtgaaaatattgatacacccaagaggaagagtgccattaat
gaccgaatggaggaccttgtgagtgctccttttgcagttgaagatgctctcgtgggttta
tttgatcacagtgatcacacccttcagaggagggttgtggaaagttatatacgtaggctc
tatcagccatatcttgtcaaagggagtgccaggatgcaatggcacagatctggtcttatt
gctacatgggagttctatgatgagtacattgaaaggaagaatggggttgaagaccaaagt
ttgagtaaaacagtggaggagaaacatagtgagaaaaagtggggagtgatggttataatt
aaatctcttcaatttttgcctgcaattatcactgctgcattgagggaggcaaccaacaac
cctcacgaagcacttacaagtggttctgtggaaccagttaactatggtaatatgatgcat
attggattagtgggcatcaacaaccagatgagtttactgcaagacagtggtgatgaggat
caagctcaagaaagaatcaataagttagctaaaatactcaaagagcaggaagtaggctcc
accatacgagctgcaggtgtcggtgtaatcagctgtatcatacaaagggatgaagggcgt
gccccaatgaggcactcctttcactggtcagaagaaaagctttactatgcggaggaacct
ctgttgcgtcatctggaacctccgctatccatttatcttgaattggacaaacttaaagcc
tatgagaatatacggtatactccatctcgagatcgtcaatggcacctctacacagttgtg
gatcacaagccacaaccaattcaaagaatgtttcttcgaacacttgtaagacagccgaca
acaaatgaaggattttcttcatatcaaaggctggatgcagaaacatctcgtacccaattg
gccatgtcctttacttcaaggagcatttttaggtctttgatggctgcaatggaggagttg
gaacttaatgcacacaatgtcaatatcaaatctgaacatgctcatatgtacctatatatc
atacgcgaacaacaaatagatgatcttgtgccctatcccaagagaattaacatagaagct
gggaaagaagaaataacagttgaggcagtcttggaagaactggcacgggaaatccattca
tctgttggtgtaagaatgcatagattaggggttgttgtgtgggaaatcaagctctggatg
gcagcctgtggacaggcaaatggtgcttggagggtcattgtaaacaatgtgactggtcat
acatgcactgtacatctataccgagaaaaggaggataccatcactcataaagtggtatac
agttcagtatcggttaagggtccactgcatggtgtggcagtgaatgaaaattatcaacct
ttaggagttattgaccgaaagcgtctttcagcaagaaagaacagcaccacatactgctat
gattttcctcttgcatttgaaactgccttggaacagtcatgggcaatccaacagccagga
tttcaaagagccaaagataaaaatcttttaaaggtaacagagcttaaatttgcagataaa
gaaggtagctggggtactcctcttgttcctgtggagaattaccctgggctcaatgatgtt
ggcatggtagcctggtttatggaaatgtgtacccctgagttcccatctggaaggacaata
ttggttgttgcaaatgatgtgaccttcaaggctggttcttttggcccaagagaggatgca
ttcttccgtgcagtaactgatcttgcatgtacaaaaaaactacctttgatttatttagct
gcaaattctggtgcccgtttaggtgtagctgaagaagtcaaatcctgtttcagagttggt
tggtctgaggaatctaatcctgagaatggctttcagtatgtatatttaacacctgaggat
aatgctcggattggatcatcggtgatagcacatgagttaaagcttgagagtggagaaacc
agatgggttatagataccattgttggcaaggaggatggccttggcgttgaaaacttgagt
ggaagtggggctattgctggtgcttattcaagggcatacaaggaaacttttacactgaca
tatgtgactggtagaactgttggaattggagcttatcttgctaggcttgggatgagatgc
atacaaaggcttgatcagcccataattcttactggtttttcagcattaaacaaacttctt
ggtcgggaggtttacagctctcacatgcaacttggtggacctaaaatcatggcaactaat
ggagtcgttcatcttacagtttccgatgatcttgaaggtgtttcttctattttgaagtgg
cttagctacattccttctcatgttggcggtgcacttcccattgtaaagccacttgatcct
ccagaaagaccagtggagtatttcccagaaaactcgtgtgatcctcgtgctgccatttct
ggaaccttggatggtaatggaagatggctgggaggaatttttgacaaagacagctttgtg
gagacactagagggatgggcaagaacagttgttacaggaagggcaaagcttggaggaatc
cctgtgggagtagttgctgtagaaacacagacggtaatgcaaataatacctgctgatcct
ggccagcttgattctcacgagagggttgttcctcaagccgggcaagtgtggttccctgat
tccgcaaccaagacagcccaagcaatattggatttcaacagagaagagctcccgcttttc
attcttgcaaactggagaggcttttcaggagggcaaagggaccttttcgaaggaattctt
caggctggttccactattgtggagaaccttagaacatacaagcagcccatatttgtatat
atcccaatgatgggcgaactccgtggtggggcatgggtggttgttgacagtagaatcaat
tcagaccacatcgaaatgtatgccgatcgaacagccaaaggtaatgtcctagagccagaa
ggaatgattgagatcaaatttagaacaagagaattgttggagagtatgggtagacttgat
cagcaattgataactctgaaggcaaaacttcaggaagccaagagtagcaggaacattgtg
gcctttgaatccctacagcagcagattaaatcacgcgagagacaacttttgcctgtgtat
acccagatagctaccaagtttgctgaactgcatgatacttccttaagaatggctgccaag
ggtgtcattagagaagttctggactggcgtaactcccgctctgtcttttaccagagactg
cacaggagaattggtgagcaatcactgatcaacagtgtgagagatgctgctggtgaccaa
ttgtcacatgcatctgcaatgaacttgctcaaagaatggtatttgaattccgatattgcc
aaaggtagagaagatgcttggttggatgatgaagccttcttcaggtggaaggatattcct
tcaaattacgagaataaactaaaggaattgcgtgtgcagaaagtgttacttcaattgaca
aatattggtgactcagctctagatttgcaagctctacctcaaggtcttgctgccctttta
agcaagttggagccattaggtcgcgtgaagttgacggatgaacttcgcaaggtacttggt
tag

DBGET integrated database retrieval system