KEGG   Glycine max (soybean): 100803679Help
Entry
100803679         CDS       T01710                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100803679
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100803679
   00640 Propanoate metabolism
    100803679
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100803679
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100803679
Enzymes [BR:gmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100803679
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100803679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 2260 aa AA seqDB search
MADIGRRNGYANSVLPNRPPAAISEVDEFCNALGGNRPIHSILIANNGMAAVKFIRSVRS
WAYETFGSEKAILLVAMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLILEMAEI
THVDAVWPGWGHASENPELPDALKAKGIVFLGPPAISMAALGDKIGSSLIAQAAEVPTLP
WSGSHVKIPPESSLITIPDEIYREACVYTTEEAVASCQVVGYPAMIKASWGGGGKGIRKV
HNDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRH
QKIIEEGPITVAPIETVKKLEQAARRLAISVNYVGAATVEYLYSMETGEYYFLELNPRLQ
VEHPVTEWIAEINLPAAQVAIGMGVPLWQIPEIRRFYGVEHGGGYDAWRKTSVLATPFDF
DKAQSTRPKGHCVAVRVTSEDPDDGFKPTSGKVQELNFKSKPNVWAYFSVKSGGGIHEFS
DSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLNASDYRENKIHTGWL
DSRIAMRVRAERPAWYLSVVGGALYKASASSAALVSDYVGYLEKGQIPPKHISLVHSQVS
LNIEGSKYTIDMIRGGSGSYRLRMNQSEIEAEIHTLRDGGLLMQLDGNSHVIYAEEEAAG
TRLLIDGRTCLLQNDHDPSKLVAETPCKLLRYLVADDSHVDADTPYAEVEVMKMCMPLLS
PASGIIHFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFTGSFPVLGPPTAISGKVHQKC
AASLNAARMILSGYEHNIDEVVQSLLNCLDSPELPFLQWQECLAVLATRLPKELKNELES
KYKEFEGISSSQIVDFPAKLLKGIIEAHLSSCPDKEKGAQERLVEPLLSLVKSYEGGRES
HAHIIVQSLFDEYLSVEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQGIKSKNKLI
LQLMDKLVYPNPVAYRDQLIRFSLLNHTNYSELALKASQLLEQTKLSELRSNIARSLSEL
EMFTEDGENIDTPKRKSAINDRMEDLVSAPFAVEDALVGLFDHSDHTLQRRVVESYIRRL
YQPYLVKGSARMQWHRSGLIATWEFYDEYIERKNGVEDQSLSKTVEEKHSEKKWGVMVII
KSLQFLPAIITAALREATNNPHEALTSGSVEPVNYGNMMHIGLVGINNQMSLLQDSGDED
QAQERINKLAKILKEQEVGSTIRAAGVGVISCIIQRDEGRAPMRHSFHWSEEKLYYAEEP
LLRHLEPPLSIYLELDKLKAYENIRYTPSRDRQWHLYTVVDHKPQPIQRMFLRTLVRQPT
TNEGFSSYQRLDAETSRTQLAMSFTSRSIFRSLMAAMEELELNAHNVNIKSEHAHMYLYI
IREQQIDDLVPYPKRINIEAGKEEITVEAVLEELAREIHSSVGVRMHRLGVVVWEIKLWM
AACGQANGAWRVIVNNVTGHTCTVHLYREKEDTITHKVVYSSVSVKGPLHGVAVNENYQP
LGVIDRKRLSARKNSTTYCYDFPLAFETALEQSWAIQQPGFQRAKDKNLLKVTELKFADK
EGSWGTPLVPVENYPGLNDVGMVAWFMEMCTPEFPSGRTILVVANDVTFKAGSFGPREDA
FFRAVTDLACTKKLPLIYLAANSGARLGVAEEVKSCFRVGWSEESNPENGFQYVYLTPED
NARIGSSVIAHELKLESGETRWVIDTIVGKEDGLGVENLSGSGAIAGAYSRAYKETFTLT
YVTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATN
GVVHLTVSDDLEGVSSILKWLSYIPSHVGGALPIVKPLDPPERPVEYFPENSCDPRAAIS
GTLDGNGRWLGGIFDKDSFVETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADP
GQLDSHERVVPQAGQVWFPDSATKTAQAILDFNREELPLFILANWRGFSGGQRDLFEGIL
QAGSTIVENLRTYKQPIFVYIPMMGELRGGAWVVVDSRINSDHIEMYADRTAKGNVLEPE
GMIEIKFRTRELLESMGRLDQQLITLKAKLQEAKSSRNIVAFESLQQQIKSRERQLLPVY
TQIATKFAELHDTSLRMAAKGVIREVLDWRNSRSVFYQRLHRRIGEQSLINSVRDAAGDQ
LSHASAMNLLKEWYLNSDIAKGREDAWLDDEAFFRWKDIPSNYENKLKELRVQKVLLQLT
NIGDSALDLQALPQGLAALLSKLEPLGRVKLTDELRKVLG
NT seq 6783 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattgggcgtaggaatggatatgcaaacagtgtactaccaaataggccacct
gctgcaatatctgaagtagatgaattctgcaatgcccttggtggaaacaggccaattcat
agtatattaattgcaaataatggaatggcagcagtcaagtttatacgtagtgttaggagc
tgggcctatgagacatttggctcagagaaagccatcttgttggttgccatggctactcca
gaggacatgagaatcaatgcagaacatatcagaatagctgatcaatttgtggaagtacct
ggtgggaccaataacaataactatgccaacgtgcagcttattcttgagatggctgagata
actcatgttgatgcggtgtggcctggttggggtcatgcatcagaaaatcctgagcttcca
gatgcattaaaagcaaaaggaattgtatttcttggacctcctgctatatctatggctgca
ttgggggataaaattggttcatcattgattgctcaagcagcggaagtgcctacccttcca
tggagtggttctcatgtgaaaattccgcctgaaagttccttgattactattcctgatgaa
atttatcgggaagcatgtgtttatacaacagaggaagcagtggcaagttgtcaagttgta
ggataccctgcaatgatcaaggcatcttggggtggtggtggtaaaggaataagaaaggtt
cataatgatgatgaggtaagggcattgttcaagcaagttcaaggtgaagttccgggttca
cccatatttataatgaaggttgcatcccagagccgacatctagaagtccagttactttgt
gatcagtacggaaatgtcgcagctttgcatagccgtgattgcagtgttcaaaggaggcac
caaaagattattgaggaggggcccattactgtagcacccatagaaacagtgaaaaaactg
gaacaggccgctagaaggttggctatatctgtaaattatgttggggcggctactgttgag
tatctttatagtatggaaactggcgagtactactttttagagttgaaccctcggctacag
gttgaacatcctgttactgagtggatagcagagataaatctgccagcagcacaagttgcc
attgggatgggtgttcctctctggcaaattcctgagataaggcgtttctatggggtggaa
catggtggagggtatgatgcttggagaaaaacatccgttttagctaccccttttgatttt
gacaaagcacaatctacaaggccaaaaggtcattgtgtggctgtgcgagtaactagtgag
gaccctgatgatggttttaagcctacaagtggcaaagtgcaggagcttaactttaaaagc
aagccaaatgtgtgggcgtacttctctgtcaagtctggaggaggaattcatgaattctca
gattcacagtttgggcatgtttttgcttttggagaatctagggctttagcaattgcaaat
atggttctggggctgaaggagattcagattcggggagaaatccgtaccaatgttgattac
accattgatcttctgaatgcttcagactacagagaaaacaaaattcacacaggttggctg
gacagtagaattgcaatgcgggttagagcagaaaggcctgcctggtatctttcggtcgtt
ggaggggcactctataaagcttctgctagcagtgcagctttggtttcagattatgttggt
tatcttgaaaagggacaaatccctcccaagcacatatctcttgtccattctcaagtgtcc
ttgaacattgaaggaagcaaatatacgattgacatgatacgaggtgggtctggaagttat
agattgagaatgaatcaatcagagatagaagcagaaatacatactttacgtgatggaggt
ttgctaatgcagttggatggaaacagtcatgtaatatatgcagaggaagaagcagctgga
actcgccttctaatagatggaaggacttgcttgcttcagaatgatcatgatccatcaaag
ttggttgcggagacaccatgcaagcttctgagatatttggttgcagatgacagtcatgtt
gatgctgacacaccatatgctgaagttgaggtcatgaaaatgtgcatgcctcttctttcg
cctgcttctgggattattcatttcaaaatgtctgaaggtcaagcaatgcaggctggtgaa
cttatagcaaggcttgatctggatgatccttcagctgtaagaaaggcagaacccttcact
gggagcttcccagttctgggacctcctactgcaatttctggtaaagttcatcagaaatgc
gctgcaagcttaaatgccgcacggatgattctctctgggtatgagcacaatattgatgaa
gttgtgcaaagtttgcttaattgccttgatagtcctgaattgcctttccttcaatggcaa
gagtgcttggcagttcttgcaacccgtcttcccaaagagctaaaaaatgagttggaatca
aaatataaggagtttgaggggatttcaagctcccaaattgttgatttccctgccaaatta
ttgaagggaattattgaagctcatctttcctcctgtcccgacaaagaaaaaggagctcaa
gaaagactagttgaacctctattgagtcttgttaagtcttatgagggtggaagagagagc
catgcccatataattgttcaatccctatttgatgagtatctttctgttgaagaattattt
agcgataatattcaggctgatgtgattgaacgtctgcgtctacaatacaagaaagatcta
ttgaagattgttgatatagtgctctctcatcagggaatcaagagtaaaaataagctgatc
ttgcaactgatggataaattggtttaccctaaccctgttgcctatagggatcagttaatc
cgtttctctttactcaaccatacaaattattctgagttggctctaaaggcaagtcaactg
ctggaacaaactaaattaagtgaacttcgatccaacattgctagaagtctttccgaatta
gagatgttcacagaggatggtgaaaatattgatacacccaagaggaagagtgccattaat
gaccgaatggaggaccttgtgagtgctccttttgcagttgaagatgctctcgtgggttta
tttgatcacagtgatcacacccttcagaggagggttgtggaaagttatatacgtaggctc
tatcagccatatcttgtcaaagggagtgccaggatgcaatggcacagatctggtcttatt
gctacatgggagttctatgatgagtacattgaaaggaagaatggggttgaagaccaaagt
ttgagtaaaacagtggaggagaaacatagtgagaaaaagtggggagtgatggttataatt
aaatctcttcaatttttgcctgcaattatcactgctgcattgagggaggcaaccaacaac
cctcacgaagcacttacaagtggttctgtggaaccagttaactatggtaatatgatgcat
attggattagtgggcatcaacaaccagatgagtttactgcaagacagtggtgatgaggat
caagctcaagaaagaatcaataagttagctaaaatactcaaagagcaggaagtaggctcc
accatacgagctgcaggtgtcggtgtaatcagctgtatcatacaaagggatgaagggcgt
gccccaatgaggcactcctttcactggtcagaagaaaagctttactatgcggaggaacct
ctgttgcgtcatctggaacctccgctatccatttatcttgaattggacaaacttaaagcc
tatgagaatatacggtatactccatctcgagatcgtcaatggcacctctacacagttgtg
gatcacaagccacaaccaattcaaagaatgtttcttcgaacacttgtaagacagccgaca
acaaatgaaggattttcttcatatcaaaggctggatgcagaaacatctcgtacccaattg
gccatgtcctttacttcaaggagcatttttaggtctttgatggctgcaatggaggagttg
gaacttaatgcacacaatgtcaatatcaaatctgaacatgctcatatgtacctatatatc
atacgcgaacaacaaatagatgatcttgtgccctatcccaagagaattaacatagaagct
gggaaagaagaaataacagttgaggcagtcttggaagaactggcacgggaaatccattca
tctgttggtgtaagaatgcatagattaggggttgttgtgtgggaaatcaagctctggatg
gcagcctgtggacaggcaaatggtgcttggagggtcattgtaaacaatgtgactggtcat
acatgcactgtacatctataccgagaaaaggaggataccatcactcataaagtggtatac
agttcagtatcggttaagggtccactgcatggtgtggcagtgaatgaaaattatcaacct
ttaggagttattgaccgaaagcgtctttcagcaagaaagaacagcaccacatactgctat
gattttcctcttgcatttgaaactgccttggaacagtcatgggcaatccaacagccagga
tttcaaagagccaaagataaaaatcttttaaaggtaacagagcttaaatttgcagataaa
gaaggtagctggggtactcctcttgttcctgtggagaattaccctgggctcaatgatgtt
ggcatggtagcctggtttatggaaatgtgtacccctgagttcccatctggaaggacaata
ttggttgttgcaaatgatgtgaccttcaaggctggttcttttggcccaagagaggatgca
ttcttccgtgcagtaactgatcttgcatgtacaaaaaaactacctttgatttatttagct
gcaaattctggtgcccgtttaggtgtagctgaagaagtcaaatcctgtttcagagttggt
tggtctgaggaatctaatcctgagaatggctttcagtatgtatatttaacacctgaggat
aatgctcggattggatcatcggtgatagcacatgagttaaagcttgagagtggagaaacc
agatgggttatagataccattgttggcaaggaggatggccttggcgttgaaaacttgagt
ggaagtggggctattgctggtgcttattcaagggcatacaaggaaacttttacactgaca
tatgtgactggtagaactgttggaattggagcttatcttgctaggcttgggatgagatgc
atacaaaggcttgatcagcccataattcttactggtttttcagcattaaacaaacttctt
ggtcgggaggtttacagctctcacatgcaacttggtggacctaaaatcatggcaactaat
ggagtcgttcatcttacagtttccgatgatcttgaaggtgtttcttctattttgaagtgg
cttagctacattccttctcatgttggcggtgcacttcccattgtaaagccacttgatcct
ccagaaagaccagtggagtatttcccagaaaactcgtgtgatcctcgtgctgccatttct
ggaaccttggatggtaatggaagatggctgggaggaatttttgacaaagacagctttgtg
gagacactagagggatgggcaagaacagttgttacaggaagggcaaagcttggaggaatc
cctgtgggagtagttgctgtagaaacacagacggtaatgcaaataatacctgctgatcct
ggccagcttgattctcacgagagggttgttcctcaagccgggcaagtgtggttccctgat
tccgcaaccaagacagcccaagcaatattggatttcaacagagaagagctcccgcttttc
attcttgcaaactggagaggcttttcaggagggcaaagggaccttttcgaaggaattctt
caggctggttccactattgtggagaaccttagaacatacaagcagcccatatttgtatat
atcccaatgatgggcgaactccgtggtggggcatgggtggttgttgacagtagaatcaat
tcagaccacatcgaaatgtatgccgatcgaacagccaaaggtaatgtcctagagccagaa
ggaatgattgagatcaaatttagaacaagagaattgttggagagtatgggtagacttgat
cagcaattgataactctgaaggcaaaacttcaggaagccaagagtagcaggaacattgtg
gcctttgaatccctacagcagcagattaaatcacgcgagagacaacttttgcctgtgtat
acccagatagctaccaagtttgctgaactgcatgatacttccttaagaatggctgccaag
ggtgtcattagagaagttctggactggcgtaactcccgctctgtcttttaccagagactg
cacaggagaattggtgagcaatcactgatcaacagtgtgagagatgctgctggtgaccaa
ttgtcacatgcatctgcaatgaacttgctcaaagaatggtatttgaattccgatattgcc
aaaggtagagaagatgcttggttggatgatgaagccttcttcaggtggaaggatattcct
tcaaattacgagaataaactaaaggaattgcgtgtgcagaaagtgttacttcaattgaca
aatattggtgactcagctctagatttgcaagctctacctcaaggtcttgctgccctttta
agcaagttggagccattaggtcgcgtgaagttgacggatgaacttcgcaaggtacttggt
tag

DBGET integrated database retrieval system