KEGG   Glycine max (soybean): 100803679Help
Entry
100803679         CDS       T01710                                 

Gene name
ACCase-A
Definition
(RefSeq) acetyl-CoA carboxylase 1-like
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00061  Fatty acid biosynthesis
gmx00620  Pyruvate metabolism
gmx00640  Propanoate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01212  Fatty acid metabolism
Module
gmx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100803679 (ACCase-A)
   00640 Propanoate metabolism
    100803679 (ACCase-A)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100803679 (ACCase-A)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100803679 (ACCase-A)
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     100803679 (ACCase-A)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100803679 (ACCase-A)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100803679 (ACCase-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Biotin_lipoyl Dala_Dala_lig_C DUF5093
Motif
Other DBs
NCBI-GeneID: 100803679
NCBI-ProteinID: XP_003526593
UniProt: I1KA18
Position
6
AA seq 2260 aa AA seqDB search
MADIGRRNGYANSVLPNRPPAAISEVDEFCNALGGNRPIHSILIANNGMAAVKFIRSVRS
WAYETFGSEKAILLVAMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLILEMAEI
THVDAVWPGWGHASENPELPDALKAKGIVFLGPPAISMAALGDKIGSSLIAQAAEVPTLP
WSGSHVKIPPESSLITIPDEIYREACVYTTEEAVASCQVVGYPAMIKASWGGGGKGIRKV
HNDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRH
QKIIEEGPITVAPIETVKKLEQAARRLAISVNYVGAATVEYLYSMETGEYYFLELNPRLQ
VEHPVTEWIAEINLPAAQVAIGMGVPLWQIPEIRRFYGVEHGGGYDAWRKTSVLATPFDF
DKAQSTRPKGHCVAVRVTSEDPDDGFKPTSGKVQELNFKSKPNVWAYFSVKSGGGIHEFS
DSQFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLNASDYRENKIHTGWL
DSRIAMRVRAERPAWYLSVVGGALYKASASSAALVSDYVGYLEKGQIPPKHISLVHSQVS
LNIEGSKYTIDMIRGGSGSYRLRMNQSEIEAEIHTLRDGGLLMQLDGNSHVIYAEEEAAG
TRLLIDGRTCLLQNDHDPSKLVAETPCKLLRYLVADDSHVDADTPYAEVEVMKMCMPLLS
PASGIIHFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFTGSFPVLGPPTAISGKVHQKC
AASLNAARMILSGYEHNIDEVVQSLLNCLDSPELPFLQWQECLAVLATRLPKELKNELES
KYKEFEGISSSQIVDFPAKLLKGIIEAHLSSCPDKEKGAQERLVEPLLSLVKSYEGGRES
HAHIIVQSLFDEYLSVEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQGIKSKNKLI
LQLMDKLVYPNPVAYRDQLIRFSLLNHTNYSELALKASQLLEQTKLSELRSNIARSLSEL
EMFTEDGENIDTPKRKSAINDRMEDLVSAPFAVEDALVGLFDHSDHTLQRRVVESYIRRL
YQPYLVKGSARMQWHRSGLIATWEFYDEYIERKNGVEDQSLSKTVEEKHSEKKWGVMVII
KSLQFLPAIITAALREATNNPHEALTSGSVEPVNYGNMMHIGLVGINNQMSLLQDSGDED
QAQERINKLAKILKEQEVGSTIRAAGVGVISCIIQRDEGRAPMRHSFHWSEEKLYYAEEP
LLRHLEPPLSIYLELDKLKAYENIRYTPSRDRQWHLYTVVDHKPQPIQRMFLRTLVRQPT
TNEGFSSYQRLDAETSRTQLAMSFTSRSIFRSLMAAMEELELNAHNVNIKSEHAHMYLYI
IREQQIDDLVPYPKRINIEAGKEEITVEAVLEELAREIHSSVGVRMHRLGVVVWEIKLWM
AACGQANGAWRVIVNNVTGHTCTVHLYREKEDTITHKVVYSSVSVKGPLHGVAVNENYQP
LGVIDRKRLSARKNSTTYCYDFPLAFETALEQSWAIQQPGFQRAKDKNLLKVTELKFADK
EGSWGTPLVPVENYPGLNDVGMVAWFMEMCTPEFPSGRTILVVANDVTFKAGSFGPREDA
FFRAVTDLACTKKLPLIYLAANSGARLGVAEEVKSCFRVGWSEESNPENGFQYVYLTPED
NARIGSSVIAHELKLESGETRWVIDTIVGKEDGLGVENLSGSGAIAGAYSRAYKETFTLT
YVTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATN
GVVHLTVSDDLEGVSSILKWLSYIPSHVGGALPIVKPLDPPERPVEYFPENSCDPRAAIS
GTLDGNGRWLGGIFDKDSFVETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADP
GQLDSHERVVPQAGQVWFPDSATKTAQAILDFNREELPLFILANWRGFSGGQRDLFEGIL
QAGSTIVENLRTYKQPIFVYIPMMGELRGGAWVVVDSRINSDHIEMYADRTAKGNVLEPE
GMIEIKFRTRELLESMGRLDQQLITLKAKLQEAKSSRNIVAFESLQQQIKSRERQLLPVY
TQIATKFAELHDTSLRMAAKGVIREVLDWRNSRSVFYQRLHRRIGEQSLINSVRDAAGDQ
LSHASAMNLLKEWYLNSDIAKGREDAWLDDEAFFRWKDIPSNYENKLKELRVQKVLLQLT
NIGDSALDLQALPQGLAALLSKLEPLGRVKLTDELRKVLG
NT seq 6783 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattgggcgtaggaatggatatgcaaacagtgtactaccaaataggccacct
gctgcaatatctgaagtagatgaattctgcaatgcccttggtggaaacaggccaattcat
agtatattaattgcaaataatggaatggcagcagtcaagtttatacgtagtgttaggagc
tgggcctatgagacatttggctcagagaaagccatcttgttggttgccatggctactcca
gaggacatgagaatcaatgcagaacatatcagaatagctgatcaatttgtggaagtacct
ggtgggaccaataacaataactatgccaacgtgcagcttattcttgagatggctgagata
actcatgttgatgcggtgtggcctggttggggtcatgcatcagaaaatcctgagcttcca
gatgcattaaaagcaaaaggaattgtatttcttggacctcctgctatatctatggctgca
ttgggggataaaattggttcatcattgattgctcaagcagcggaagtgcctacccttcca
tggagtggttctcatgtgaaaattccgcctgaaagttccttgattactattcctgatgaa
atttatcgggaagcatgtgtttatacaacagaggaagcagtggcaagttgtcaagttgta
ggataccctgcaatgatcaaggcatcttggggtggtggtggtaaaggaataagaaaggtt
cataatgatgatgaggtaagggcattgttcaagcaagttcaaggtgaagttccgggttca
cccatatttataatgaaggttgcatcccagagccgacatctagaagtccagttactttgt
gatcagtacggaaatgtcgcagctttgcatagccgtgattgcagtgttcaaaggaggcac
caaaagattattgaggaggggcccattactgtagcacccatagaaacagtgaaaaaactg
gaacaggccgctagaaggttggctatatctgtaaattatgttggggcggctactgttgag
tatctttatagtatggaaactggcgagtactactttttagagttgaaccctcggctacag
gttgaacatcctgttactgagtggatagcagagataaatctgccagcagcacaagttgcc
attgggatgggtgttcctctctggcaaattcctgagataaggcgtttctatggggtggaa
catggtggagggtatgatgcttggagaaaaacatccgttttagctaccccttttgatttt
gacaaagcacaatctacaaggccaaaaggtcattgtgtggctgtgcgagtaactagtgag
gaccctgatgatggttttaagcctacaagtggcaaagtgcaggagcttaactttaaaagc
aagccaaatgtgtgggcgtacttctctgtcaagtctggaggaggaattcatgaattctca
gattcacagtttgggcatgtttttgcttttggagaatctagggctttagcaattgcaaat
atggttctggggctgaaggagattcagattcggggagaaatccgtaccaatgttgattac
accattgatcttctgaatgcttcagactacagagaaaacaaaattcacacaggttggctg
gacagtagaattgcaatgcgggttagagcagaaaggcctgcctggtatctttcggtcgtt
ggaggggcactctataaagcttctgctagcagtgcagctttggtttcagattatgttggt
tatcttgaaaagggacaaatccctcccaagcacatatctcttgtccattctcaagtgtcc
ttgaacattgaaggaagcaaatatacgattgacatgatacgaggtgggtctggaagttat
agattgagaatgaatcaatcagagatagaagcagaaatacatactttacgtgatggaggt
ttgctaatgcagttggatggaaacagtcatgtaatatatgcagaggaagaagcagctgga
actcgccttctaatagatggaaggacttgcttgcttcagaatgatcatgatccatcaaag
ttggttgcggagacaccatgcaagcttctgagatatttggttgcagatgacagtcatgtt
gatgctgacacaccatatgctgaagttgaggtcatgaaaatgtgcatgcctcttctttcg
cctgcttctgggattattcatttcaaaatgtctgaaggtcaagcaatgcaggctggtgaa
cttatagcaaggcttgatctggatgatccttcagctgtaagaaaggcagaacccttcact
gggagcttcccagttctgggacctcctactgcaatttctggtaaagttcatcagaaatgc
gctgcaagcttaaatgccgcacggatgattctctctgggtatgagcacaatattgatgaa
gttgtgcaaagtttgcttaattgccttgatagtcctgaattgcctttccttcaatggcaa
gagtgcttggcagttcttgcaacccgtcttcccaaagagctaaaaaatgagttggaatca
aaatataaggagtttgaggggatttcaagctcccaaattgttgatttccctgccaaatta
ttgaagggaattattgaagctcatctttcctcctgtcccgacaaagaaaaaggagctcaa
gaaagactagttgaacctctattgagtcttgttaagtcttatgagggtggaagagagagc
catgcccatataattgttcaatccctatttgatgagtatctttctgttgaagaattattt
agcgataatattcaggctgatgtgattgaacgtctgcgtctacaatacaagaaagatcta
ttgaagattgttgatatagtgctctctcatcagggaatcaagagtaaaaataagctgatc
ttgcaactgatggataaattggtttaccctaaccctgttgcctatagggatcagttaatc
cgtttctctttactcaaccatacaaattattctgagttggctctaaaggcaagtcaactg
ctggaacaaactaaattaagtgaacttcgatccaacattgctagaagtctttccgaatta
gagatgttcacagaggatggtgaaaatattgatacacccaagaggaagagtgccattaat
gaccgaatggaggaccttgtgagtgctccttttgcagttgaagatgctctcgtgggttta
tttgatcacagtgatcacacccttcagaggagggttgtggaaagttatatacgtaggctc
tatcagccatatcttgtcaaagggagtgccaggatgcaatggcacagatctggtcttatt
gctacatgggagttctatgatgagtacattgaaaggaagaatggggttgaagaccaaagt
ttgagtaaaacagtggaggagaaacatagtgagaaaaagtggggagtgatggttataatt
aaatctcttcaatttttgcctgcaattatcactgctgcattgagggaggcaaccaacaac
cctcacgaagcacttacaagtggttctgtggaaccagttaactatggtaatatgatgcat
attggattagtgggcatcaacaaccagatgagtttactgcaagacagtggtgatgaggat
caagctcaagaaagaatcaataagttagctaaaatactcaaagagcaggaagtaggctcc
accatacgagctgcaggtgtcggtgtaatcagctgtatcatacaaagggatgaagggcgt
gccccaatgaggcactcctttcactggtcagaagaaaagctttactatgcggaggaacct
ctgttgcgtcatctggaacctccgctatccatttatcttgaattggacaaacttaaagcc
tatgagaatatacggtatactccatctcgagatcgtcaatggcacctctacacagttgtg
gatcacaagccacaaccaattcaaagaatgtttcttcgaacacttgtaagacagccgaca
acaaatgaaggattttcttcatatcaaaggctggatgcagaaacatctcgtacccaattg
gccatgtcctttacttcaaggagcatttttaggtctttgatggctgcaatggaggagttg
gaacttaatgcacacaatgtcaatatcaaatctgaacatgctcatatgtacctatatatc
atacgcgaacaacaaatagatgatcttgtgccctatcccaagagaattaacatagaagct
gggaaagaagaaataacagttgaggcagtcttggaagaactggcacgggaaatccattca
tctgttggtgtaagaatgcatagattaggggttgttgtgtgggaaatcaagctctggatg
gcagcctgtggacaggcaaatggtgcttggagggtcattgtaaacaatgtgactggtcat
acatgcactgtacatctataccgagaaaaggaggataccatcactcataaagtggtatac
agttcagtatcggttaagggtccactgcatggtgtggcagtgaatgaaaattatcaacct
ttaggagttattgaccgaaagcgtctttcagcaagaaagaacagcaccacatactgctat
gattttcctcttgcatttgaaactgccttggaacagtcatgggcaatccaacagccagga
tttcaaagagccaaagataaaaatcttttaaaggtaacagagcttaaatttgcagataaa
gaaggtagctggggtactcctcttgttcctgtggagaattaccctgggctcaatgatgtt
ggcatggtagcctggtttatggaaatgtgtacccctgagttcccatctggaaggacaata
ttggttgttgcaaatgatgtgaccttcaaggctggttcttttggcccaagagaggatgca
ttcttccgtgcagtaactgatcttgcatgtacaaaaaaactacctttgatttatttagct
gcaaattctggtgcccgtttaggtgtagctgaagaagtcaaatcctgtttcagagttggt
tggtctgaggaatctaatcctgagaatggctttcagtatgtatatttaacacctgaggat
aatgctcggattggatcatcggtgatagcacatgagttaaagcttgagagtggagaaacc
agatgggttatagataccattgttggcaaggaggatggccttggcgttgaaaacttgagt
ggaagtggggctattgctggtgcttattcaagggcatacaaggaaacttttacactgaca
tatgtgactggtagaactgttggaattggagcttatcttgctaggcttgggatgagatgc
atacaaaggcttgatcagcccataattcttactggtttttcagcattaaacaaacttctt
ggtcgggaggtttacagctctcacatgcaacttggtggacctaaaatcatggcaactaat
ggagtcgttcatcttacagtttccgatgatcttgaaggtgtttcttctattttgaagtgg
cttagctacattccttctcatgttggcggtgcacttcccattgtaaagccacttgatcct
ccagaaagaccagtggagtatttcccagaaaactcgtgtgatcctcgtgctgccatttct
ggaaccttggatggtaatggaagatggctgggaggaatttttgacaaagacagctttgtg
gagacactagagggatgggcaagaacagttgttacaggaagggcaaagcttggaggaatc
cctgtgggagtagttgctgtagaaacacagacggtaatgcaaataatacctgctgatcct
ggccagcttgattctcacgagagggttgttcctcaagccgggcaagtgtggttccctgat
tccgcaaccaagacagcccaagcaatattggatttcaacagagaagagctcccgcttttc
attcttgcaaactggagaggcttttcaggagggcaaagggaccttttcgaaggaattctt
caggctggttccactattgtggagaaccttagaacatacaagcagcccatatttgtatat
atcccaatgatgggcgaactccgtggtggggcatgggtggttgttgacagtagaatcaat
tcagaccacatcgaaatgtatgccgatcgaacagccaaaggtaatgtcctagagccagaa
ggaatgattgagatcaaatttagaacaagagaattgttggagagtatgggtagacttgat
cagcaattgataactctgaaggcaaaacttcaggaagccaagagtagcaggaacattgtg
gcctttgaatccctacagcagcagattaaatcacgcgagagacaacttttgcctgtgtat
acccagatagctaccaagtttgctgaactgcatgatacttccttaagaatggctgccaag
ggtgtcattagagaagttctggactggcgtaactcccgctctgtcttttaccagagactg
cacaggagaattggtgagcaatcactgatcaacagtgtgagagatgctgctggtgaccaa
ttgtcacatgcatctgcaatgaacttgctcaaagaatggtatttgaattccgatattgcc
aaaggtagagaagatgcttggttggatgatgaagccttcttcaggtggaaggatattcct
tcaaattacgagaataaactaaaggaattgcgtgtgcagaaagtgttacttcaattgaca
aatattggtgactcagctctagatttgcaagctctacctcaaggtcttgctgccctttta
agcaagttggagccattaggtcgcgtgaagttgacggatgaacttcgcaaggtacttggt
tag

DBGET integrated database retrieval system