KEGG   Glycine max (soybean): 100804027Help
Entry
100804027         CDS       T01710                                 

Definition
lecithin-cholesterol acyltransferase-like 1-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gmx00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 443 aa AA seqDB search
MKKEQEEGLKIEVATLTVTVVVVMLSLLCTCGASNLDPLILIPGNGGNQLEARLTNQYKP
STFICESWYPLIKKKNGWFRLWFDSSVILAPFTQCFAERMTLHYHQELDDYFNTPGVETR
VPHFGSTNSLLYLNPRLKHITGYMAPLVDSLQKLGYADGETLFGAPYDFRYGLAAEGHPS
QVGSKFLKDLKNLIEEASNSNNGKPVILLSHSLGGLFVLQLLNRNPPSWRKKFIKHFIAL
SAPWGGAIDEMYTFASGNTLGVPLVDPLLVRDEQRSSESNLWLLPNPKIFGPQKPIVITP
NKTYSAHDMVDFLKDIGFPEGVYPYETRILPLIGNIKAPQVPITCIMGTGVGTLETLFYG
KGDFDERPEISYGDGDGTVNLVSLLALQSLWKEEKNQYLKVVKIDGVSHTSILKDEVALN
EIVGEITSINSHAELGLSNLFSG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaacaagaagagggtctcaagattgaggttgctacactcacagttacagta
gttgttgtgatgctgtcattgctatgcacatgtggggcaagcaacctcgaccctttgatt
ctaataccaggtaacggagggaaccaactagaagcaaggttgaccaatcagtacaagccc
tctactttcatctgcgaatcatggtaccctctcatcaagaaaaagaatggatggttcaga
ctttggtttgattccagtgtcatacttgctcctttcactcaatgctttgccgaacgcatg
acccttcattaccaccaagaactcgatgattacttcaacactcctggggttgagacccgg
gtccctcactttggttccaccaactctcttctctatctcaatcctcgtctcaagcatatc
accggatacatggcacccctggtagattcattacaaaagcttggctacgctgatggtgag
actctgtttggagccccttatgactttagatatggtctagctgctgaaggtcacccttca
caagtgggttccaagttcctcaaagatctaaagaatttgatagaagaagcaagcaattcc
aataatgggaagccagtgatacttctctcccacagtttaggaggcctatttgtcctacaa
ctactaaatagaaaccccccctcttggcgcaaaaaattcatcaaacacttcattgctctt
tcagctccatggggtggtgctatagacgaaatgtacacctttgcatctggcaacactttg
ggagtgcccctagtggaccctttattagtgagggatgaacaaagaagctccgagagtaac
ctttggcttttgcctaacccaaaaatttttggtcctcaaaaaccaatagtgataactcca
aataagacctattcagctcatgacatggttgattttctaaaagacattggttttcctgaa
ggggtttatccttatgaaacacgaattctacccttgatagggaacataaaagcaccacaa
gtgcctataacttgtattatgggaacgggagtgggaaccttggaaacattgttttatggg
aaaggtgattttgatgaacggccagaaatatcatatggggatggtgatggaacggtgaac
ttggtgagcttgttggcgcttcaatcactatggaaagaggagaaaaatcaataccttaaa
gtggttaagatagatggggtgtctcatacttcaatacttaaggatgaagttgcactaaat
gaaatagtaggtgagattacttcaattaattctcatgctgagctcggtttaagtaatttg
ttttcggggtaa

DBGET integrated database retrieval system