KEGG   Glycine max (soybean): 100804260Help
Entry
100804260         CDS       T01710                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gmx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gmx00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:gmx00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 425 aa AA seqDB search
MVHYMAQQYSSSSWSCNLSKMAGLALCLLVMLSYASSSYARLLLNRTRGGFMVSREAHRR
NLLDNGLGHTPPMGWNSWNHFACNIKEDLIRETADAMVSTGLAALGYQYINIDDCWGELN
RDSKGNLVPKASTFPSGMKALADYIHKKGLKLGIYSDAGNQTCSKTMPGSLGHEKQDAKT
FASWGIDYLKYDNCENNNISPKERYPPMSEALANTGRPIFFSLCEWGSEDPATWAKSVGN
SWRTTGDIEDKWESMISRADLNDKWASCAGPGGWNDPDMLEVGNGGMTTEEYRAHFSIWA
LAKAPLLIGCDIRALDATTKELLSNNEVIAVNQDKLGVQGKKVKSNNDLEVWAGPLSNNK
VAVILWNRSSSKAKVTASWSDIGLKPGTSVKARDLWAHSTQSSVSGEISSELDSHACKMY
VLSPN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtacactacatggcacaacaatattcatcctcaagttggagctgcaatttatccaag
atggcagggcttgccttgtgcctccttgtgatgttgagctatgcaagttcttcatatgct
cgtttgttgttgaatagaacaagaggagggttcatggtgtctagagaggcacataggaga
aacctgcttgataatggacttggccatacaccccccatgggatggaatagctggaaccat
tttgcctgcaatattaaagaagacttgattcgagaaacagccgatgctatggtgtcaact
ggccttgctgctctaggataccaatatattaacatagatgattgttggggagagctcaac
cgagactcaaagggcaatttggttcccaaagcctcaacgtttccttcaggaatgaaggct
ctagctgattatattcataaaaaaggtttgaagttgggaatctattctgatgcaggaaat
caaacatgcagtaaaactatgcctggatcactaggacatgaaaaacaagatgcaaaaaca
tttgcttcctgggggattgactacttgaagtatgataactgtgagaataacaatataagc
cccaaagaaaggtaccctccaatgagtgaagctttggcaaacactggaagaccaattttc
ttctctttgtgtgaatggggatcagaagatccagcaacttgggccaaaagtgtgggaaat
agttggagaacaacaggagacattgaagataagtgggaaagtatgatatctcgtgcagat
ctaaatgacaaatgggcttcttgtgctggacctggaggatggaatgatcctgacatgcta
gaagttggaaatggaggcatgacaacagaagaatatcgcgctcatttcagcatatgggca
ttagctaaggctcctttattgattggttgtgacattagagcattggatgccaccacaaaa
gaattgctaagcaacaacgaagttattgcagtaaaccaagacaagcttggagttcaagga
aagaaggtgaaaagtaataatgatttggaggtttgggcaggtcctctcagtaataacaag
gtagcagtgatcttatggaatagaagttcatccaaagcaaaagttactgcatcctggtct
gacataggcctgaaaccaggaacttcagttaaagcaagagatttatgggcgcattcaaca
caatcatctgtttcgggagaaatatcttctgaattagattcacatgcttgtaagatgtat
gtcctaagtcctaactaa

DBGET integrated database retrieval system