KEGG   Glycine max (soybean): 100804724Help
Entry
100804724         CDS       T01710                                 

Definition
histone deacetylase 15-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100804724
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100804724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 421 aa AA seqDB search
MDKEIYVGSQESVANSSTAIGFDERMLLHAEVEKKSTLHPERPDRLQAIAASLARAGIFP
GKCYSIPAREITPEELITVHSLEHIESVEVTSESLSSYFTSDTYANEHSALAARLAAGLC
ADLASAIVSGRAKNGFALVRPPGHHAGVRQAMGFCLHNNAAVAALAAQAAGARKVLILDW
DVHHGNGTQEIFEQNKSVLYISLHRHEGGKFYPGTGAAEEVGSMGAEGFCVNIPWSQGGV
GDNDYIFAFQHVVLPIAAEFNPDLTIVSAGFDAARGDPLGCCDITPSGYAHMTNMLNALS
GGKLLVILEGGYNLRSISSSATAVIKVLLGESPGCELENSFPSKAGLQTVLEVLKIQMNF
WPALGPIFVNLESQWRMYCFERKRKQIKKRRRVLVPMWRWGRKSLLFHFLNGHHNVKSKL
C
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagagatctatgttggttcacaggaatcagtggcaaatagttctactgctatc
ggctttgacgagagaatgttgttacatgcagaagttgaaaagaaatcaactctgcatcct
gagaggccagatcgtcttcaagccattgccgctagtcttgctagagctggcatatttcct
ggaaaatgctattcaattcctgctagagaaatcacaccagaagaacttattacggttcat
tcgttggagcatattgaatctgtggaagttacaagtgaatcactttctagttatttcacg
tctgatacatatgccaatgagcattcagcacttgctgctaggttggcagctgggttatgt
gctgatctagcatcagcaattgtttctgggcgagccaaaaatggatttgctttggttagg
cctcctggtcatcatgctggtgtaagacaggcaatggggttctgccttcacaataatgct
gccgtggctgcattggcagctcaggctgcaggggctaggaaggtgctaattttggattgg
gatgttcatcatggaaatgggacacaagaaatatttgaacaaaacaaatctgtcttgtat
atatcattgcatagacatgagggaggaaagttttatcctggtactggagctgccgaagag
gttggtagtatgggtgcagaaggattctgtgtgaatattccatggagtcaaggaggagtt
ggtgacaatgactatatttttgcatttcagcatgttgtccttcctatagctgctgagttt
aatccagatcttaccatagtatctgctggatttgatgctgcaagaggtgatcccctagga
tgttgtgatattactccctctggatatgcacatatgacaaatatgttgaatgccctttct
ggtggaaaattgcttgttattcttgaggggggctataatcttcgttctatatcgtcttct
gcaactgcagtaatcaaggtattattgggtgagagtcctggatgtgaactggaaaatagc
ttcccttccaaagctggcctgcaaactgttctggaagtgctcaaaattcagatgaacttt
tggcctgccttgggtcccatttttgtgaatttggagtcacaatggaggatgtactgtttt
gaaagaaaaaggaaacagattaagaaacgacgccgagttctggttccaatgtggaggtgg
ggacgaaaaagtttgttattccattttctgaacggccaccataatgtaaaatcaaagtta
tgttga

DBGET integrated database retrieval system