KEGG   Glycine max (soybean): 100804754Help
Entry
100804754         CDS       T01710                                 

Definition
AMSH-like ubiquitin thioesterase 1-like
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100804754
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100804754
Peptidases [BR:gmx01002]
 Metallo Peptidases
  Family M67
   100804754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 519 aa AA seqDB search
MRSSSSDRNRINIAASAQKVDVDNRISLRFYYRIADNILRQADIFRAEKNIIDLYVMLLR
FSSLVSETIPRHRDYRSSPPRQKESLKKKLLISLNELENLKPVVQQKINELNSKLAYQQN
GQGKFSSNNSLDFSPVKKQTSASYGLIKAVRPTAGEFVYQGSRSQPFSYVRPVEEHARRL
SLTLPPPKEETLSRHSILGPNGLKGQWRPPIIDKGIKYPSNIDLSPVELPSLQHSLEDES
LKKKDNSIAEHHKSELDSILTQSEDCQPHPQPQPQHDQEPPSLISFETTETSARIEVIRQ
PSPPPVLAEVQDLVPAVSPCVNEAGCKTEIPSSDSSVHVEAPMQLHISTALMESFMKLAK
SNTKKNLETCGVLAGLLKNRKFYITALIIPKQESTSDSCQTTNEEEIFEVQDKRSLFPLG
WIHTHPTQSCFMSSIDLHTHYSYQIMLPESVAIVMAPRDSSRNHGIFRLTAPGGMSVIKQ
CDQRGFHPHSQPPDGGPIYKTCTDVYMNPDLKFEVIDLR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcttcttcttcggacaggaacaggatcaacatcgctgccagtgctcagaaagtc
gatgtcgataaccgaatctctctccgattctactaccgcatcgccgataacatcctccga
caggccgatatctttcgtgcagagaagaatattattgacctatatgtcatgcttttaaga
ttttctagtttggtgtcggagacaataccacgtcaccgagactatagatcatctccacca
aggcagaaagaatcattgaaaaagaaattgttaatttctttgaatgaactggagaacttg
aaaccagtggtccaacagaagatcaatgagcttaacagcaaacttgcataccaacaaaat
ggacagggaaaatttagttcaaataattcactggatttttctcccgtgaaaaagcaaact
tcggctagttatggcctaataaaggctgtcaggcctactgctggggagtttgtttaccaa
ggatcaaggagccaacctttctcttatgtcaggcctgtggaagagcatgcacgaagacta
tctctaactcttccacctccaaaggaagaaactctctctagacattctatccttggtccc
aacgggctaaaagggcagtggagaccacctatcattgataaagggatcaagtatccaagc
aacatagatctgtctcctgttgaattaccaagcctacaacattccttggaagatgaatct
ctgaaaaagaaggataacagcattgcagaacaccataaatcagagttagattcaattcta
acccaaagtgaggactgccagccccatccccaacctcagcctcagcatgatcaggagcct
ccttctcttatttcttttgagacaactgaaacctctgctcgaatagaagttatcagacaa
ccttctcctccacccgtacttgctgaagtacaagatttggtccctgcagtgtcaccttgt
gttaatgaggcaggatgtaagacagagattccatcatcagatagttctgttcatgtcgag
gctccaatgcaattgcacatttcaactgctttaatggagagttttatgaagcttgccaag
tcaaatacaaaaaaaaatttagagacttgtggtgtccttgctggtttgcttaaaaacaga
aaattttatattactgcccttataatcccaaagcaggagtcaacatcagattcttgtcag
actacaaatgaagaggaaatatttgaagtgcaagataaacggtctctttttccccttggg
tggatccatacacatcctacacaatcttgttttatgtcatcaattgatctgcacacccat
tactcctatcagattatgctgccagaatctgttgcaatagttatggcgccaagagatagt
tcgagaaaccatggcatttttcggttgacagcccctggtggaatgtctgtgattaaacaa
tgtgatcaacgtggctttcatccacatagtcagcctccagatggtggtccgatttacaag
acatgtacagatgtatacatgaacccagatttaaaatttgaggtaattgatcttcgatga

DBGET integrated database retrieval system