KEGG   Glycine max (soybean): 100804924Help
Entry
100804924         CDS       T01710                                 

Definition
protein disulfide isomerase-like 1-4-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100804924
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100804924
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100804924
  Exosomal proteins of colorectal cancer cells
   100804924
  Exosomal proteins of bladder cancer cells
   100804924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 558 aa AA seqDB search
MRILVLLSLATLLLFSSFSPTFCDHLADDEDLSFLDEPSAAPEHDHHYGADDSNFGDFED
FEEDDAEAYKQPEVDEKDVVVLKEKNFTDAVKNNRFVMVEFYAPWCGHCQALAPEYAAAA
TELKGEDVILAKVDATEENELAQQYDVQGFPTVHFFVDGIHKPYNGQRTKDAIVTWIRKK
IGPGIYNLTTVEEAQRILTNETKVVLGFLNSLVGPESEELAAASRLEDDVNFYQTVNPDV
AKLFHIDQDVKRPALILIKKEEEKLNHFDGKFEKSAIADFVFSNKLPLVTIFTRESAPSV
FENPIKKQLLLFATSNDSETLVPAFKEAAKSFKGKLIFVYVEMDNEDVGKPVSEYFGISG
NAPKVLGYTGNDDGKKFVLDGEVTTDKIKAFGEDFVEDKLKPFYKSDPVPESNDGDVKIV
VGNNFDEIVLDESKDVLLEIYAPWCGHCQSLEPIYNKLAKHLRNIDSLVIAKMDGTTNEH
PRAKPDGFPTLLFFPAGNKSFDPITVDTDRTVVAFYKFLKKHASIPFKLQKPTSTSESDS
KGSSDAKESQSSDVKDEL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctcgtcctgctctctctcgccacccttctcctcttctcctccttctctccc
accttctgcgaccacctcgccgacgacgaggacctcagcttcctcgacgagccctccgcc
gcgccggagcacgaccaccactacggcgccgatgactccaatttcggcgactttgaggac
ttcgaggaggacgacgcggaggcgtacaagcagcccgaggtggacgagaaggacgtcgtc
gttttgaaggagaagaacttcaccgacgccgtcaagaacaaccgcttcgtcatggtcgag
ttctacgcgccctggtgcggccactgccaggccctcgcgccggagtacgccgccgccgcg
acggaactcaagggcgaagacgtaattttggcaaaggtggatgccaccgaggagaatgaa
ttggcgcagcagtacgatgttcagggtttccccactgtccacttcttcgttgatggcatt
cacaagccttataatggccaaaggaccaaagatgctatagtgacgtggattaggaagaag
atcggacctggcatatacaacttgactacagtggaggaggctcaacgcattttgaccaac
gaaactaaagttgttttgggcttcctcaactctttagttggtcctgagagtgaggagctt
gctgctgcttcaaggcttgaggatgatgtcaatttttatcaaactgtgaatcctgatgtg
gcaaagcttttccatattgaccaagatgttaagcgtccagcattgatcctcattaagaaa
gaggaggaaaaacttaaccactttgatggaaaattcgagaagtcagcaatagcggacttt
gtcttctccaacaagcttcctttggtaacaatttttacaagagaaagtgccccatcagtc
tttgaaaatccaatcaagaaacagttgttgctgtttgcaacttcaaatgattcagagact
ttggtcccagcatttaaagaagcagcaaagtctttcaagggaaagttgatctttgtatat
gtggaaatggataacgaagatgttggaaagcctgtttcagaatactttggtatcagtggg
aatgctccaaaagtacttggatacactgggaatgatgatggaaaaaaatttgtgcttgat
ggagaggtgactactgacaaaattaaggcatttggggaagatttcgttgaagacaagcta
aaacctttttacaagtcagatccagttcctgaaagtaatgatggtgatgtgaaaatagta
gttggtaataattttgatgaaattgtcttggatgagtcaaaggatgttctcctcgagatt
tatgctccctggtgtggccattgccaatcactggagccaatatacaacaagcttgcaaaa
catcttcgcaatattgattctcttgtaatagccaagatggatggaacaacaaatgagcat
cccagggctaagcctgatggattccccactcttctcttcttcccggcaggaaacaagagt
tttgaccctattactgttgatacagatcgtacagtggtagccttctacaagttcctcaag
aaacatgcatcaatcccattcaagctccagaaaccaacctcaacttctgaatccgattcc
aaggggagctctgatgccaaagagagccagagtagtgatgtgaaggacgaattatga

DBGET integrated database retrieval system