KEGG   Glycine max (soybean): 100805396Help
Entry
100805396         CDS       T01710                                 

Definition
histone H2B.4-like
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Brite
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100805396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 138 aa AA seqDB search
MAPPKAEKKPAEKKPAEKAPAEKKPKAEKKISKEGGSEKKKKRTKKSVETYKIYIFKVLK
QVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGEL
AKHAVSEGTKAVTKFTSS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctcccccaaaggccgagaagaagcccgcggagaaaaagcccgcagagaaggctccg
gcggagaagaagcccaaggccgagaagaagatatcgaaggaaggaggaagcgagaagaag
aagaagagaacaaagaagagcgtggagacctacaagatttacatcttcaaggtgctgaag
caggttcaccccgacatcggaatctcaagcaaggccatggggatcatgaacagtttcata
aacgacatcttcgagaagctcgcccaggagtcgtcgcgattggctaggtataacaagaag
cctaccattacttccagggagatccaaacggcggtgcgtttggtcctccctggggagttg
gccaaacacgctgtctctgaaggtaccaaggccgtcaccaagttcaccagctcttga

DBGET integrated database retrieval system