KEGG   Glycine max (soybean): 100805656Help
Entry
100805656         CDS       T01710                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
gmx  Glycine max (soybean)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gmx00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 488 aa AA seqDB search
MDPQQRPLMSDRVTVNGSVTPLALLADGRLWWSEGIQRCLSIEKDVLGIVASGPYIKIKS
LVETRDGCCITSAPARLVRNDVVFMPSSEESHRLWCHKLREFIDSLGRPKRLLVFVNPFG
GKKSATKIFAEQVKPLFEDAHIQITVQETKHQLHAKEVARSLDITKYDGIVCVSGDGILV
EVVNGLLQREDWDTAIKMPLGVVPAGTGNGMAKSLLDSVGDPCEVANAVLAIIRGSKRPL
DVATITQGETRFFSILMLAWGLVADIDIESEKYRWMGSARLDFYGLCRLLNLRQYIGCVS
FVPAPGYEAFGEPTSYPGKSTTSKGSNNDPSEAERANLQRLCYLGPEINLENLNWRVING
PFISVWLHNVPWGAEDTMAAPDAKFSDGYLDLIIIKNCPTLPLLSMMSELNKGGHVKSPY
VTYLKVKAFNLQPGPRTKDQEKEGIIDSDGEVLARGKGTYKCEQKTLMAYDKLQITVDQG
LATLFTPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagcagcgtccgttaatgtcggaccgggtcaccgttaacggctccgtcacg
ccgcttgctcttctcgccgacggccgtctatggtggtctgagggaatccaacggtgtttg
tcgatcgaaaaggacgtcctcgggatcgttgccagtgggccctacataaaaatcaagagc
ctcgtggagacccgagacggatgctgcatcaccagcgcccctgcaagactcgttagaaac
gacgtcgtctttatgccttcctccgaggaatctcacaggctctggtgccataaacttcgt
gaattcattgattctctcggtcgtcctaagaggttgttggtttttgttaatccgtttggt
gggaagaaatccgctacgaagattttcgctgaacaagtgaaacctctttttgaagatgct
catatccaaatcacagttcaagaaaccaagcaccagctccatgcaaaggaagttgctcgt
tcgctagatattactaaatacgatgggattgtttgtgttagtggagatggaattttggtt
gaggttgtaaatggtcttctccaaagagaggattgggatacggcaataaagatgcccctt
ggggtagttcctgcaggtacgggaaatggcatggcaaaatctcttcttgattcagttggt
gatccttgtgaagtagctaatgccgttcttgccattatacgaggcagtaaacgaccgctt
gatgtagctaccatcacacaaggggaaaccagatttttcagtatattgatgctcgcatgg
ggtctggtggcagatattgacattgagtctgaaaagtaccggtggatgggaagtgctcgt
ctagatttttatggtctctgtcgactcctcaatttgaggcaatacattggatgtgtttct
tttgtgcctgcacctgggtatgaagcttttggggagcccacaagttaccctggcaaatct
actactagcaaaggaagcaacaatgatccaagtgaagcagaacgtgctaatttgcaaaga
ctttgctatctaggacctgaaataaatttggaaaatctgaattggagagttataaatgga
ccctttatttctgtctggcttcacaatgtaccttggggtgccgaagacacaatggcagcg
cctgatgcaaagttctccgatggttatttggacttgatcattatcaagaattgcccaacg
ttgccattattgtcaatgatgtcagagttgaataaaggaggacatgtaaaatctccatat
gtcacgtacctaaaggtgaaggctttcaacttgcaacctggtccacgcaccaaggaccaa
gagaaagaagggatcatagattcagatggtgaggttcttgcaagagggaaaggaacttac
aagtgtgagcagaagactttgatggcctatgataaattacagataacagtggatcaaggt
ttagcaacactttttacccctttataa

DBGET integrated database retrieval system