KEGG   Glycine max (soybean): 100805830Help
Entry
100805830         CDS       T01710                                 

Definition
mitogen-activated protein kinase homolog D5-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
gmx  Glycine max (soybean)
Pathway
Plant hormone signal transduction
Class
Environmental Information Processing; Signal transduction; Plant hormone signal transduction [PATH:gmx04075]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 433 aa AA seqDB search
MTVFTEVRRERERESTDLFDQNPSQHINQTDKRKKEENNRAMEGGGAAPPADTVMSDAAP
PPQQPPVAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALN
SETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAIRDIVPPPQREIFNDVYI
AYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCD
LKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKP
LFPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAI
DLVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCLTPFSFDFEQHALTEEQMKELI
YREALAFNLEYQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttttacagaagttaggagagagagagagagagagagtacagatctgtttgac
caaaacccctcacaacacataaatcagacagacaaaagaaagaaagaagagaacaacaga
gcaatggaaggaggaggagctgctccgccggccgacaccgtgatgtccgacgcggcgcca
ccgccgcagcagcctccggtggcgatggggatcgagaatattccggcgacgctgagccac
ggtggcaggttcatccaatacaacatattcggcaacatattcgaagtcaccgccaaatac
aagccacccatcatgcccatcggaaaaggcgcatacggcatcgtttgctcggctttgaac
tcggagacgaatgagcacgttgccatcaagaagattgcgaatgcatttgacaacaagatt
gatgcaaagaggaccctccgtgaaatcaagctgcttcgtcacatggatcatgaaaacgtt
gttgcaatcagggatatagtgccaccacctcaaagggagatattcaatgatgtttacatt
gcatatgagttgatggacactgaccttcaccaaatcattcgttcaaatcaagcattatca
gaggagcactgtcagtattttctgtatcaaatcctccgtgggttgaagtacatacattct
gctaatgttctgcatagggacttaaaaccgagcaaccttctcctaaatgccaactgcgac
ttaaaaatttgtgattttggactggctcgtgtcacctctgaaactgattttatgactgaa
tatgttgttacgagatggtaccgtgcaccggagcttctgttgaactcttctgactacact
gcagcaattgatgtatggtctgttggttgtattttcatggaactgatggatcgaaagcct
ttgtttcctggcagagatcacgtgcatcagttgcgtctacttatggagctgattggcacc
ccatcagaggctgatttggggtttctgaatgaaaatgctaagagatacattaggcaactg
cccctttaccgccgtcaatctttccaggaaaagtttccacatgtccatcctgaagctata
gatcttgtagaaaaaatgttaacttttgatcctagaaaaaggattactgttgaagatgca
ctggcgcacccatacttgacatctctgcatgacatcagtgatgaacctgtgtgcttgact
cccttcagctttgactttgaacaacatgctttgactgaggaacagatgaaagaactgata
taccgagaggctctagcatttaacctcgagtatcagcagtag

DBGET integrated database retrieval system