KEGG   Glycine max (soybean): 100805830Help
Entry
100805830         CDS       T01710                                 

Definition
mitogen-activated protein kinase homolog D5-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
gmx  Glycine max (soybean)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    100805830
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100805830
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100805830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 433 aa AA seqDB search
MTVFTEVRRERERESTDLFDQNPSQHINQTDKRKKEENNRAMEGGGAAPPADTVMSDAAP
PPQQPPVAMGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALN
SETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAIRDIVPPPQREIFNDVYI
AYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCD
LKICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKP
LFPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAI
DLVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCLTPFSFDFEQHALTEEQMKELI
YREALAFNLEYQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttttacagaagttaggagagagagagagagagagagtacagatctgtttgac
caaaacccctcacaacacataaatcagacagacaaaagaaagaaagaagagaacaacaga
gcaatggaaggaggaggagctgctccgccggccgacaccgtgatgtccgacgcggcgcca
ccgccgcagcagcctccggtggcgatggggatcgagaatattccggcgacgctgagccac
ggtggcaggttcatccaatacaacatattcggcaacatattcgaagtcaccgccaaatac
aagccacccatcatgcccatcggaaaaggcgcatacggcatcgtttgctcggctttgaac
tcggagacgaatgagcacgttgccatcaagaagattgcgaatgcatttgacaacaagatt
gatgcaaagaggaccctccgtgaaatcaagctgcttcgtcacatggatcatgaaaacgtt
gttgcaatcagggatatagtgccaccacctcaaagggagatattcaatgatgtttacatt
gcatatgagttgatggacactgaccttcaccaaatcattcgttcaaatcaagcattatca
gaggagcactgtcagtattttctgtatcaaatcctccgtgggttgaagtacatacattct
gctaatgttctgcatagggacttaaaaccgagcaaccttctcctaaatgccaactgcgac
ttaaaaatttgtgattttggactggctcgtgtcacctctgaaactgattttatgactgaa
tatgttgttacgagatggtaccgtgcaccggagcttctgttgaactcttctgactacact
gcagcaattgatgtatggtctgttggttgtattttcatggaactgatggatcgaaagcct
ttgtttcctggcagagatcacgtgcatcagttgcgtctacttatggagctgattggcacc
ccatcagaggctgatttggggtttctgaatgaaaatgctaagagatacattaggcaactg
cccctttaccgccgtcaatctttccaggaaaagtttccacatgtccatcctgaagctata
gatcttgtagaaaaaatgttaacttttgatcctagaaaaaggattactgttgaagatgca
ctggcgcacccatacttgacatctctgcatgacatcagtgatgaacctgtgtgcttgact
cccttcagctttgactttgaacaacatgctttgactgaggaacagatgaaagaactgata
taccgagaggctctagcatttaacctcgagtatcagcagtag

DBGET integrated database retrieval system