KEGG   Glycine max (soybean): 100805932Help
Entry
100805932         CDS       T01710                                 

Definition
histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gmx00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 708 aa AA seqDB search
MEHHFGQGTAEPASESFDKARVLNVKPLRTLVPVFPSPSNPASSSTPQGGAPFVCVSPSG
PFPSGVAPFYPFFISPESQRLSEQNAQTPTSQRVAAGPISTAVPINSFRTPTGAANGDVG
SSRKNARSRGQITDEDGHSNVEIEEIDADKGTGTGRLKRKSNKKTKARHIGGSVSVDVDP
DAVAADILKSLNPMVFDVLNQPEGSRDSVAYTLMTYEVMRRKLGQIEDSNKAANSGAKRP
DLKAGALMMSKGIRTNSKKRIGGVPGVEIGDIFFFRFELCLVGLHAPSMAGIDYIGTKTS
QEEEPLAVSIVSSGGYEDNVDDGDVLIYSGQGGVNRDKGASDQKLERGNLALEKSAHRGN
EVRVIRGLRDPQHPTGKIYVYDGLYKIQNSWVEKAKSGFNVFKYKLVRLPEQPQAYMIWK
SIQQWTEKSASRAGVILPDLTSGAENVPVCLVNDVDNEKGPAYFTYIPTLKNLRPTAPVE
SSTGCPCVGGCQSKNFNCPCIQKNGGYLPYSSALLLADLKSVIYECGPSCQCPSNCRNRV
SQSGLKFRLEVFRTKNKGWGLRSWDSIRAGTFICEYAGEVIDSARVEELGGDNEDDYIFD
STRIYQQLEVFPGDTEAPKIPSPLYISAKNEGNVSRFMNHSCSPNVLWRPVIRENKNESD
LHIAFYAIRHIPPMMELTYDYGTVLPLKVGQRKKKCLCGSVKCKGYFC
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccattttggtcaaggcactgcagaacctgcatctgaatcctttgataaggct
agggttttaaatgtgaagccattaagaactcttgttcctgtgttcccttcaccatctaat
cctgcttcatcttcaactccacaaggtggtgccccttttgtgtgtgtttctccttctggc
cctttcccttcaggggttgcacccttctatcctttcttcatctccccagaatcccagagg
ctctctgaacagaatgcgcaaaccccgaccagtcaacgcgtggctgcgggtccaatatct
actgcagttccaattaattcatttaggacaccaactggggctgctaatggagatgtgggc
tcgtcacgaaagaatgccagaagtcgtggacagatcacagacgaagatggccacagtaat
gttgagatagaagaaattgatgcagacaaaggaactgggactgggaggttaaagcgcaag
tcgaataagaagacaaaggcacgacatattggtggttctgtttctgttgatgttgatccg
gatgcagttgccgctgatattctcaaatcactcaacccaatggtttttgatgtacttaat
caaccagaaggtagcagggactcagttgcgtatacactcatgacatatgaagtgatgcga
agaaagcttggacaaattgaagattcaaataaggcagctaactctggagcaaaacggcct
gatttgaaggcaggtgcacttatgatgagtaaagggattcggaccaacagcaagaaacgt
attggaggtgtgcctggtgttgagattggggatattttctttttcagatttgaattgtgc
ttagtgggcttacatgctccttctatggctggaattgactacattggtaccaaaaccagt
caagaagaagagcccttagctgtaagtatcgtctcatctggagggtatgaagataatgtg
gatgatggggatgtgctgatttacagtggccaaggtggggtgaaccgtgacaagggagca
agtgatcaaaagcttgaaaggggtaatcttgcgttggagaagagtgcgcatagaggtaat
gaagtgagagtaattaggggtttgagggatccacaacatccaactgggaagatttacgtc
tatgatggcctttacaagattcaaaattcctgggtggagaaagcaaaatctggtttcaat
gtattcaagtataaattagtcaggttgcctgaacagcctcaagcatatatgatttggaaa
tccattcaacaatggactgagaaatctgcttcaagagctggggttatattgcctgatctt
acttctggggctgaaaatgtacctgtttgtcttgtgaatgatgttgataacgagaagggc
cctgcatatttcacttacatcccaactctcaagaatttgaggccaactgctcctgtggaa
tcttctactggatgcccttgtgttggtggatgtcaatctaaaaattttaactgcccttgc
attcaaaagaatggaggctatcttccatattcttcagctttgctacttgcggacctaaaa
tctgtgatatatgagtgtggcccttcttgtcaatgtccttctaattgccgaaatcgggtt
tctcaaagtggcttgaaatttcgtttggaggttttcagaaccaagaataaaggttggggt
cttagatcatgggattctattcgtgcaggaactttcatatgtgagtatgcaggggaagtc
atagatagtgctagagtggaggagcttggtggtgacaatgaagatgattacatttttgat
tctactcgcatttatcagcaactggaagtttttcctggtgatactgaagctccgaaaatc
ccatcccccctttatatatcagcaaaaaatgaaggaaatgtttctcggtttatgaaccac
agctgctctccaaatgtattatggcgtccagtcatacgtgaaaataagaacgagtcagat
ctccacattgctttctatgcaattagacatatccctcctatgatggagttgacttatgat
tatgggactgttcttcctctcaaagtaggtcagaggaaaaagaaatgcttatgtggatct
gtgaaatgcaaaggttacttttgttaa

DBGET integrated database retrieval system