KEGG   Glycine max (soybean): 100806079Help
Entry
100806079         CDS       T01710                                 

Definition
magnesium-chelatase subunit ChlH, chloroplastic-like
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gmx00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1384 aa AA seqDB search
MASLVSSPFTLPNSKVDQLSSLAQRHLFLHSFLPKKANGYASSSKASLRVKCAAMGNGLF
TQTTPEVRRIVPEKNQGLPTVKIVYVVLEAQYQSSLSAAVRVLNSNKKDASFEVVGYLVE
ELRDESTYKTFCKDLEDANIFIGSLIFVEELALKVKAVVEKERDRLDAVLVFPSMPEVMR
LNKLGSFSMSQLGQSKSPFFQLFKKKKQSSAGFADSMLKLVRTLPKVLKYLPSDKAQDAR
LYILSLQFWLGGSPDNLQNFLKMISGSYVPALKGTKMEYSEPVLYLDSGIWHPLAPCMYD
DVKEYLNWYGTRRDANEKLKSPNAPVIGLILQRSHIVTGDDGHYVAVIMELEARGAKVIP
IFAGGLDFSGPVERYLIDPITKKPFVNSVVSLTGFALVGGPARQDHPRAVEALMKLDVPY
IVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPKTGKSHALHKR
VEQLCTRAIKWAELKRKTKEEKKLAITVFSFPPDKGNVGTAAYLNVFSSIFSVLKDLQRD
GYNVEGLPETSEALIEEVIHDKEAQFSSPNLNVAYKMNVREYQSLTPYATALEENWGKPP
GNLNSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYSFVEKIF
KADAVLHFGTHGSLEFMPGKQVGMSDVCYPDSLIGNIPNIYYYAANNPSEATIAKRRSYA
NTISYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIISTARQCNLDKDVEL
PEEGEEIPAKDRDLVVGKVYAKIMEIESRLLPCGLHVIGEPPSALEAVATLVNIAALDRP
EDGISSLPSILAETVGRSIEEVYRGSDKGILKDVELLRQITEASRGAITSFVQRTTNKKG
QVVDVADKLTSILGFGINEPWVEYLSNTKFYRADREKLRTLFDFLGECLKLVVADNELGS
LKQALEGKYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAAMQSAKIVVDRLIERQK
AENGGKYPETVALVLWGTDNIKTYGESLAQVLWMIGVNPVADTFGRVNRVEPVSLEELGR
PRIDVVVNCSGVFRDLFINQMNLLDRAVKMVAELDEPAEQNFVRKHALEQAQALGIDVRE
AATRVFSNASGSYSSNINLAVENSSWNDEKQLQDMYLSRKSFAFDCDAPGAGMTEKRKVF
EMALSTADATFQNLDSSEISLTDVSHYFDSDPTNLVQSLRKDGKKPSAYVADTTTANAQV
RTLAETVRLDARTKLLNPKWYEGMLSTGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEA
NTTFIQDEEMLKKLMNTNPNSFRKLVQTFLEANGRGYWETSEDNIDKLRQLYSEVEDKIE
GIDR
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttagtgtcttctccatttaccttacccaattctaaggttgatcaactctct
tctcttgcccagagacacctttttcttcattctttccttcccaagaaggccaatggctat
gctagcagctcaaaagcttccctgagagtgaaatgtgctgctatgggcaatggtcttttc
actcaaaccacgccggaagtgcgtcggatagttcccgagaagaaccaaggcctgccaact
gttaaaattgtgtatgttgtgcttgaggctcagtaccaatcatctctctctgctgctgtt
agagttctcaacagcaacaagaaagatgcttcctttgaggttgtgggctacttggtcgag
gagcttcgcgatgagtccacctacaagaccttctgcaaggacttggaagatgccaacatt
ttcatagggtcactaatttttgtggaggagcttgccctcaaggtcaaggctgttgtggag
aaggaaagggacaggcttgatgcagttttggtgttcccatcaatgcctgaggtgatgagg
ctcaacaagttggggtctttcagcatgtcacagcttggacaatccaagagcccctttttc
cagctcttcaagaagaagaagcagtcctctgccgggttcgccgacagcatgttgaagctg
gtgaggactttgccaaaggtgttgaagtacttgccaagtgacaaggctcaggatgccagg
ctgtacattctgagtctgcagttttggcttggcggatcacctgataacttgcaaaacttc
ctcaagatgatttccgggtcttatgttccggcgttgaaagggacaaagatggagtactcg
gagccggttttgtacttggacagtggaatttggcaccctctagctccttgtatgtatgat
gatgtgaaggagtatttgaattggtatggaaccagaagggatgctaatgagaagctgaag
agtccgaatgcaccagtgattggtttgattttgcaaaggagtcacattgtgactggggat
gatggccactatgtggctgtgatcatggagcttgaggctagaggtgctaaggttatcccg
atttttgccggtggcctcgacttttcggggccagtggagaggtacttgattgatccaatc
actaagaaaccgtttgtgaattctgtggtgtcactgaccggctttgcgcttgttggaggc
cccgcaaggcaggaccatccaagggcagttgaggctttgatgaagctagatgttccttac
attgttgcattgccattggtgttccagacaacagaagagtggctgaacagtactttgggt
ttgcatccaattcaggttgctctacaagttgcactgccagagctagatgggggcatggag
cctatagtttttgctggtcgagatcccaaaacaggaaaatctcatgctcttcacaagaga
gtggagcagctctgcactagggcaataaaatgggctgaattgaaaaggaaaacaaaggaa
gagaagaaactagcaatcactgtcttcagtttcccaccagacaaaggcaatgtaggaact
gcagcctacctgaatgtcttctcctccattttctctgttctaaaagatcttcaaagagat
ggttacaatgttgagggacttccagaaacttcagaagctttgattgaagaagtaatacat
gacaaagaagctcaatttagcagcccaaatctgaacgttgcttacaaaatgaatgtccga
gaataccaaagtctaactccctatgccacagcattagaagaaaactggggaaaacctcct
gggaatctgaattcagatggagagaatctattggtatatgggaaacaatatggtaatgta
ttcataggtgttcaacccacatttggctatgaaggcgatcctatgcggttgcttttctcc
aaatctgcaagtcctcatcatggatttgcagcatattactcttttgttgagaaaattttc
aaagctgatgctgttcttcattttgggacacatggttcccttgaattcatgcctggaaag
caggtggggatgagtgatgtatgttatccagacagtctgattgggaacattcctaatatc
tattactatgctgcaaacaacccttctgaggctaccatcgccaaacgaaggagctatgcg
aataccatcagctatctgactcctccagcagaaaatgcaggactgtacaaaggtcttaag
cagttaagtgagctcatctcctcataccagtccctcaaggacactggccgcgggccacaa
attgtgagctcaattatcagcacagctagacaatgtaatcttgacaaggatgtggaactg
ccagaagagggtgaagagatcccagcaaaagatcgcgaccttgtggttggaaaggtgtat
gccaagatcatggagattgagtctcgcctgcttccttgtgggctccatgtcattggtgag
ccaccctcagccttggaagcagttgcaacactagtgaacatagctgcacttgatcgtccc
gaagatggtatttcctctctcccatcaatactagctgagactgttggaagaagcattgag
gaagtttatagagggagtgacaaaggaatactaaaggatgtagagcttcttcggcagata
actgaagcttcgcgtggagcaattacttcctttgtgcagaggactactaataagaagggt
caagttgttgacgtagctgataaacttacctcaatccttggatttggcataaatgaacca
tgggtcgagtacttgtcaaacaccaaattttaccgagctgatagggaaaaactcagaacc
ttgttcgatttcttgggagaatgtttgaagttggttgtagccgataatgaattgggaagt
ttgaaacaagccttggagggtaagtatgtggagccaggacctggtggcgatccaattaga
aatcctaaagttttaccgacagggaagaatattcacgccctggacccacaagctattcct
actacagcagcaatgcaaagtgccaaaatagtggtggatagattgattgagaggcagaaa
gctgaaaatgggggaaagtatcctgagactgttgcacttgtattgtggggaacagataat
attaagacatatggtgagtccctggctcaggtcttgtggatgattggtgtgaatccagta
gctgatacctttggaagggtcaaccgggtggaacctgtaagtcttgaagagcttggaagg
ccaaggattgatgttgttgttaattgttcaggagtattcagggaccttttcatcaatcag
atgaatcttctggatagagcagtgaagatggttgctgaattggatgaaccagcagagcaa
aactttgtgaggaagcatgcactagaacaagctcaagcccttgggattgacgttagagaa
gcagcaacaagggtcttctccaatgcctcagggtcctactcctcaaacataaacctggca
gtggagaattcttcatggaatgatgagaagcagctccaggacatgtaccttagccgaaag
tctttcgcttttgactgcgatgcgcctggtgcaggcatgacagaaaaaagaaaggtcttt
gagatggctctgagcacagcagatgccacattccaaaaccttgattcatcagaaatctcc
ctcactgatgtcagtcattactttgactcagatccaacaaacctggttcaaagtctaaga
aaagatgggaagaagccaagtgcatacgttgctgacacaaccactgctaatgctcaggtg
cgtacccttgctgagacggttcgacttgatgcaagaaccaagctattgaaccccaagtgg
tatgaaggcatgctgtctactggatacgagggtgttcgcgagatagagaagaggctcact
aacacagttggatggagtgcaacctcaggccaagtcgacaactgggtgtatgaagaagcc
aacacaactttcattcaagatgaggaaatgttgaagaagctaatgaacacaaatccaaac
tcctttaggaagctggtgcagacattcttggaagccaatggacgcggttactgggagact
tcagaagacaacattgacaagctcaggcagttgtactcagaagtggaagacaaaatagaa
ggcattgatcgctga

DBGET integrated database retrieval system