KEGG   Glycine max (soybean): 100806140Help
Entry
100806140         CDS       T01710                                 

Definition
probable histone H2B.1-like
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 136 aa AA seqDB search
MAKGEKKPAEKKPAEKAPAEKTKAEKKIPKEPASGEKKKKKRNKKSVETYKIYIFKVLKQ
VHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELA
KHAVSEGTKAVTKFTS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggagagaagaaaccggcggagaagaagcccgcggagaaggctccggcggag
aaaacaaaagccgagaagaagatcccaaaggaacccgcctcgggcgagaagaagaagaag
aagagaaacaagaagagcgtggagacgtacaagatctacatattcaaggtgctgaagcaa
gtgcaccctgacatcgggatctccagcaaagccatggggatcatgaacagcttcatcaac
gacatcttcgagaagctcgctcaggaatcttccaggctcgcgcgctacaacaagaagcct
accatcacctctcgcgagatccagaccgccgttcgtcttgttctccccggcgagctcgcc
aagcacgctgtctccgaaggcaccaaggctgtcacaaagttcactagctaa

DBGET integrated database retrieval system