KEGG   Glycine max (soybean): 100806161Help
Entry
100806161         CDS       T01710                                 

Definition
formamidopyrimidine-DNA glycosylase-like
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gmx  Glycine max (soybean)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gmx03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 399 aa AA seqDB search
MPELPEVEAARRAVEYNCVGKRITKCVVADDSKVIHGVSPSDFQASVLGKLIVAAHRKGK
NMWLQLDSPPFPSFQFGMAGAIYIKGAAVTNYKRSAVKDEDEWPSKYSKIFIELDDGLEL
SFTDKRRFAKVRLLKDPTSVPPISELGPDALFEPMTLEKFTESLHKKKTEIKALLLDQSF
ISGIGNWVADEVLYQARIHPRQVASSLSNESCSNLSKCIKEVIEKAIEVGAESSQYPTNW
IFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLSGSLDVKETGKPNKRQASKKVR
VDDDTEKPTNGEVDDLGSVKSKKGTKAGAKGRKPSKKKKSGGSDEDKDSSDVGTDYDSDQ
VEKKNPGNVASRKQAGGEKQSNRRVQSNQTSWSAKRKAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttccagaggtagaggcggcgaggagggccgttgagtataactgcgtcgga
aagaggataacaaagtgcgttgtcgccgatgattctaaggtgatccatggtgtctctccc
tccgacttccaagcttccgtcctcggcaagctcatcgtcgctgctcaccgtaagggaaag
aacatgtggcttcaacttgattctcctccttttccttccttccaattcggtatggctggt
gctatatacattaaaggagctgcagtaacaaactataaaaggtctgctgtaaaagacgag
gatgagtggccctcaaaatattcaaaaattttcattgagttagatgatggtttggagttg
tctttcactgacaaaaggcgatttgctaaagttcgtctgctcaaagatccgacatcagtg
cctcccatatccgagcttggtcctgatgcacttttcgaacctatgacacttgagaagttt
acggagtctttgcacaagaagaaaactgaaatcaaggctttattacttgatcaaagcttt
atttcaggtattggaaattgggtggcagatgaagtgttataccaagcaagaattcatccg
cggcaggtggcttctagcctgtctaatgaaagctgctcaaatttgagcaagtgcattaaa
gaggtcattgaaaaagcaattgaagttggagcagaaagtagtcagtatcccaccaattgg
atatttcattcacgtgaaaagaagcccggcaaggcttttgttgatgggaaaaaaattgac
ttcatcacagctggtggcaggacaactgcttacgtgccagagttgcaaaagctaagtgga
tctctagatgtaaaagaaactggtaagcctaataaaaggcaagcctcaaagaaagtaagg
gtagatgatgacactgaaaaaccaacaaatggggaagtggacgatttgggaagtgtcaaa
tcaaagaaggggacaaaggctggagctaaaggtaggaagccttcaaaaaagaaaaagtca
gggggaagtgatgaagacaaagatagtagtgatgttggtactgattatgatagtgatcaa
gttgaaaagaagaatccaggcaacgtggctagtaggaaacaagctgggggagagaagcaa
tcaaacaggagagttcaaagcaatcaaactagttggagtgctaaaaggaaagctaagtaa

DBGET integrated database retrieval system