KEGG   Glycine max (soybean): 100806320Help
Entry
100806320         CDS       T01710                                 

Definition
PAP-specific phosphatase HAL2-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gmx  Glycine max (soybean)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gmx00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 383 aa AA seqDB search
MEKEEDKYAKELEVAVRVVHVACALCGRVQERLLATTNDHVVAKDDDSPVTVADFSVQAT
ISWLLSEILGVQNVSIVAEEDIETISKDESASLLEAVVNTVNESLAFASKYGLQCPETTL
GTPEVLEAIARCNSTGGPRGRYWVLDPVDGTLGFVRGDQYAVALALIEDGKVVLGVLGCP
NYPVKIEWLNYHYQHHQTMPESSLKTPDTGGKGCVLYARKGSGEAWLQSLIDGDNMLEWP
NCARLIRVSSIDDPALATLCEPVERANSNHSFTAGLAHSVGLRKQPLRVHSMVKYAAIAR
GDAEIFMKFAKCGYKEKIWDHAAGVVIVEEAGGVVTDAGGRPLDFSKGMYLEGLDRGIIA
CSGVALHEKLIDAVYASWDSSNL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggaagaggacaagtacgcgaaggaattggaagtggccgttagggtggtccac
gtggcgtgtgctctctgcgggagggtgcaggagaggctccttgccaccaccaatgatcac
gttgtggccaaggatgatgattctcccgttactgtcgcagactttagtgttcaagcaact
attagttggttactatcagaaattttgggggttcaaaatgtgtcaatcgttgccgaagaa
gacatagaaaccatctccaaggatgaatcagcaagcttactggaagctgttgtgaatact
gtgaatgaatctttggcttttgcatccaagtatggtcttcaatgtccagagacaactcta
gggacgcctgaagttcttgaggccattgcccgttgcaactcaactggaggccccagggga
agatattgggtacttgaccctgttgatggcacattaggatttgtacgtggcgatcagtat
gctgttgctctagctctgattgaggatggaaaagttgttcttggagttctggggtgtcct
aattacccagtaaagatagaatggcttaattatcattaccagcatcatcaaacaatgcca
gagtcgtctctaaaaactcctgataccgggggaaaaggatgtgtattgtatgcaagaaaa
ggcagtggtgaggcatggctgcagtcattaattgatggagataacatgctagagtggcca
aattgtgctaggcttattcgtgtttcttcgattgatgatccggcattggcaactctctgt
gaaccagtggaaagggcaaactcaaaccattcattcacagctggacttgctcacagtgtg
ggacttagaaaacagcccttgcgcgtgcacagcatggtaaaatacgcagcaatagcccga
ggagacgcggagatattcatgaaatttgcaaagtgcggctacaaggagaagatatgggat
catgctgctggtgttgttattgttgaagaggctggtggtgtggtaactgatgccgggggg
cgcccactggacttttcaaagggaatgtacttagaaggtcttgacagaggcataattgca
tgctctggtgtcgcattgcatgaaaaattaattgatgctgtttatgctagctgggactcc
tcaaatttatga

DBGET integrated database retrieval system