KEGG   Glycine max (soybean): 100806320Help
Entry
100806320         CDS       T01710                                 

Definition
PAP-specific phosphatase HAL2-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gmx  Glycine max (soybean)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100806320
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100806320
Transfer RNA biogenesis [BR:gmx03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100806320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 383 aa AA seqDB search
MEKEEDKYAKELEVAVRVVHVACALCGRVQERLLATTNDHVVAKDDDSPVTVADFSVQAT
ISWLLSEILGVQNVSIVAEEDIETISKDESASLLEAVVNTVNESLAFASKYGLQCPETTL
GTPEVLEAIARCNSTGGPRGRYWVLDPVDGTLGFVRGDQYAVALALIEDGKVVLGVLGCP
NYPVKIEWLNYHYQHHQTMPESSLKTPDTGGKGCVLYARKGSGEAWLQSLIDGDNMLEWP
NCARLIRVSSIDDPALATLCEPVERANSNHSFTAGLAHSVGLRKQPLRVHSMVKYAAIAR
GDAEIFMKFAKCGYKEKIWDHAAGVVIVEEAGGVVTDAGGRPLDFSKGMYLEGLDRGIIA
CSGVALHEKLIDAVYASWDSSNL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggaagaggacaagtacgcgaaggaattggaagtggccgttagggtggtccac
gtggcgtgtgctctctgcgggagggtgcaggagaggctccttgccaccaccaatgatcac
gttgtggccaaggatgatgattctcccgttactgtcgcagactttagtgttcaagcaact
attagttggttactatcagaaattttgggggttcaaaatgtgtcaatcgttgccgaagaa
gacatagaaaccatctccaaggatgaatcagcaagcttactggaagctgttgtgaatact
gtgaatgaatctttggcttttgcatccaagtatggtcttcaatgtccagagacaactcta
gggacgcctgaagttcttgaggccattgcccgttgcaactcaactggaggccccagggga
agatattgggtacttgaccctgttgatggcacattaggatttgtacgtggcgatcagtat
gctgttgctctagctctgattgaggatggaaaagttgttcttggagttctggggtgtcct
aattacccagtaaagatagaatggcttaattatcattaccagcatcatcaaacaatgcca
gagtcgtctctaaaaactcctgataccgggggaaaaggatgtgtattgtatgcaagaaaa
ggcagtggtgaggcatggctgcagtcattaattgatggagataacatgctagagtggcca
aattgtgctaggcttattcgtgtttcttcgattgatgatccggcattggcaactctctgt
gaaccagtggaaagggcaaactcaaaccattcattcacagctggacttgctcacagtgtg
ggacttagaaaacagcccttgcgcgtgcacagcatggtaaaatacgcagcaatagcccga
ggagacgcggagatattcatgaaatttgcaaagtgcggctacaaggagaagatatgggat
catgctgctggtgttgttattgttgaagaggctggtggtgtggtaactgatgccgggggg
cgcccactggacttttcaaagggaatgtacttagaaggtcttgacagaggcataattgca
tgctctggtgtcgcattgcatgaaaaattaattgatgctgtttatgctagctgggactcc
tcaaatttatga

DBGET integrated database retrieval system