KEGG   Glycine max (soybean): 100806347Help
Entry
100806347         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100806347
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100806347
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100806347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 554 aa AA seqDB search
MLPRNPSYTNPEPCQHLAEYKLKHGFNGYKAIQKLLVTSPIGKTSVKKPNTKVPRCGFCN
GCEGRFYLCLICSSFSCLDHTLLHPQSESGHAVFVDIERTELYCGVCRDQLYDPDFDQVV
MSKHSMGVAGGATGNESIGQRLIKRRRLVSGIVGLDLQKSKCRVSTKDLRGKSCYPLGLR
GLNNLGSTCYMNSVLQVLLHAPPFRDYFLSGGQRLEACHHRRATDLMCCLLCDVNAIFSA
VYSGDRSPYSPAQFLYSWWQHSANLACYEQQDAHEFFISMLDAIHEKEGKTRNGSKGNGD
CQCIAHKVFYGLLRSDVTCMACGFTSTTYDPCVDISLNLDTDVSSTEKGKKLTKQNEDGS
MSTLSGCLDLFTRPEKLGSDQKLYCQNCRERQDSLKQMSIRKLPLVLSLHVKRFEHSFVK
KCSRKIDRYLHFPFSLDMTPYLSSSILRARYGNRNFTFGGDQSDMFSEFEIFAVVTHSGT
LESGHYVSFVRVRNQWYRCNDAWITVVDEATVRASQCYMIFYVQKTLHNKANEDLSHVPN
SPGRDLFLPIAGCC
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgttgccaagaaacccttcatacacaaacccagaaccctgccagcaccttgctgagtac
aagctcaagcatggcttcaatggctacaaagccatccaaaagctcctcgtgacctctcca
attgggaaaaccagtgtgaagaaacccaacacaaaggtacccagatgcggtttctgtaat
gggtgtgaagggaggttctatctatgcctgatttgttcttcattttcatgtttggatcac
acccttttgcaccctcaatctgaatctggtcatgctgtatttgtagacattgaaaggact
gaactttattgtggagtgtgccgtgatcaattgtatgaccctgattttgaccaagttgtg
atgtctaagcactcaatgggggtggcaggtggtgccactgggaatgaaagcattggccag
agattgatcaagaggaggagattggtttctgggattgttggattggatttgcagaaatct
aagtgcagagtttccaccaaagatctgaggggaaaatcgtgttatcctttggggttgagg
gggttgaacaatcttggtagcacgtgctacatgaattctgtgttgcaagtgttgctacat
gcacctcctttcagagactatttcctgagtggtggacaacgtttggaagcttgtcatcat
agaagagccacggatctgatgtgttgtttgctttgtgatgtcaatgctattttttcggca
gtgtattcgggggatcgaagtccgtatagtcctgctcagtttctctacagctggtggcag
cattcagcaaatttagcatgttatgagcagcaggatgctcacgagtttttcatttcgatg
ttagatgctatccatgagaaagagggcaaaacaaggaatggaagcaaaggtaatggagac
tgtcaatgcattgctcataaggtgttctatgggttattgagatcagatgttacctgtatg
gcctgtggattcacctcaacaacctatgacccttgtgtggacatttcacttaacttggat
accgatgtctcttcaactgaaaagggtaaaaaacttaccaaacaaaatgaggatggcagt
atgtctacactttcgggttgtttagatttgttcacaagaccagagaagttggggtcagac
cagaaactttactgccagaattgtcgggaaaggcaggactcgttgaagcaaatgtcaatt
aggaagctcccattagtacttagtttgcatgtaaaacgatttgagcactcttttgttaaa
aagtgttcaagaaaaatagatcgctacctacacttcccattttccttagacatgactcca
tatctgtcctcctcaatcctcagagccagatatgggaatagaaattttacttttgggggt
gatcaatcagatatgttttctgagttcgagatttttgcagtggtgacacattcggggaca
ctcgagtctggccattatgtttcttttgtgcgtgtaaggaatcaatggtacagatgcaat
gatgcttggataactgtggttgatgaggctacagtcagagcttcacagtgttacatgatt
ttttatgtgcaaaaaactctgcacaataaagcaaatgaagacctgagtcacgtgccaaat
tcccctggaagagacctatttcttcctattgctggatgttgctag

DBGET integrated database retrieval system