KEGG   Glycine max (soybean): 100807282Help
Entry
100807282         CDS       T01710                                 

Definition
AMSH-like ubiquitin thiolesterase 2-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100807282
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100807282
Peptidases [BR:gmx01002]
 Metallo Peptidases
  Family M67
   100807282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 291 aa AA seqDB search
MYKRSNEEKDVSSKKVRNCDTAESNIQSAIVDGEDTSEIPSFPLGNLSTSWCSLVCKPAA
IKTANRYFLLQKVTQSWPSPALCFVETVPQDAQSSHVTAFNSGDGSSKSDNERDVHISMR
LMEDFLDLAKENTEKDLETCGILGAYLEKGTLYLTTLIIPKQESASNSCQATNEEEVFKI
LNERSLYPVGWIHTHPSQSCFMSSVDLHTQYSYQVMIPEAFAIVLAPNDTSRSCGLFRLT
KPEGMNILKNCQETGFHPHKEPDNGSPVYEHCSNVYKNSNLRFEIFDLRQK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaggtctaatgaagaaaaggatgtaagtagtaagaaggttagaaattgtgat
acagcagaaagcaatattcaaagcgcgattgtcgatggcgaggacacatctgagattcca
tcattcccattaggaaatttgagtactagttggtgctcactggtttgtaaaccggctgct
attaagacagccaacagatacttcttgcttcaaaaagtaactcagtcctggccttcccct
gccttgtgttttgtggagacagtgcctcaagatgcacaaagttctcatgttacagctttt
aattcaggtgatggatcctcaaagtcggacaacgaacgggatgttcatatttcaatgcgg
ttaatggaggactttcttgatcttgctaaagaaaatacagaaaaggatttggaaacttgt
ggtatacttggtgcctatcttgagaagggaaccctctatttgactaccctgatcatacca
aagcaggaatcagcttccaattcttgtcaagctacaaatgaggaggaagtttttaaaatt
ctaaatgaaagatccctttatcctgtgggatggatccatacacatccttctcaaagttgt
ttcatgtcatcggtggatctgcacactcaatattcctaccaggtgatgattcctgaggca
tttgccattgtcttggcaccaaatgatacctcaaggagctgtggattatttcgtctgacc
aaacctgaaggaatgaatattctaaaaaattgccaggagacaggatttcacccacacaaa
gaaccagacaatggcagccccgtatatgagcactgctccaatgtgtacaaaaactccaat
ctaaggtttgaaatctttgatttacgccaaaaatga

DBGET integrated database retrieval system