KEGG   Glycine max (soybean): 100807282Help
Entry
100807282         CDS       T01710                                 

Definition
AMSH-like ubiquitin thiolesterase 2-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:gmx04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 291 aa AA seqDB search
MYKRSNEEKDVSSKKVRNCDTAESNIQSAIVDGEDTSEIPSFPLGNLSTSWCSLVCKPAA
IKTANRYFLLQKVTQSWPSPALCFVETVPQDAQSSHVTAFNSGDGSSKSDNERDVHISMR
LMEDFLDLAKENTEKDLETCGILGAYLEKGTLYLTTLIIPKQESASNSCQATNEEEVFKI
LNERSLYPVGWIHTHPSQSCFMSSVDLHTQYSYQVMIPEAFAIVLAPNDTSRSCGLFRLT
KPEGMNILKNCQETGFHPHKEPDNGSPVYEHCSNVYKNSNLRFEIFDLRQK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaggtctaatgaagaaaaggatgtaagtagtaagaaggttagaaattgtgat
acagcagaaagcaatattcaaagcgcgattgtcgatggcgaggacacatctgagattcca
tcattcccattaggaaatttgagtactagttggtgctcactggtttgtaaaccggctgct
attaagacagccaacagatacttcttgcttcaaaaagtaactcagtcctggccttcccct
gccttgtgttttgtggagacagtgcctcaagatgcacaaagttctcatgttacagctttt
aattcaggtgatggatcctcaaagtcggacaacgaacgggatgttcatatttcaatgcgg
ttaatggaggactttcttgatcttgctaaagaaaatacagaaaaggatttggaaacttgt
ggtatacttggtgcctatcttgagaagggaaccctctatttgactaccctgatcatacca
aagcaggaatcagcttccaattcttgtcaagctacaaatgaggaggaagtttttaaaatt
ctaaatgaaagatccctttatcctgtgggatggatccatacacatccttctcaaagttgt
ttcatgtcatcggtggatctgcacactcaatattcctaccaggtgatgattcctgaggca
tttgccattgtcttggcaccaaatgatacctcaaggagctgtggattatttcgtctgacc
aaacctgaaggaatgaatattctaaaaaattgccaggagacaggatttcacccacacaaa
gaaccagacaatggcagccccgtatatgagcactgctccaatgtgtacaaaaactccaat
ctaaggtttgaaatctttgatttacgccaaaaatga

DBGET integrated database retrieval system