KEGG   Glycine max (soybean): 100807487Help
Entry
100807487         CDS       T01710                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
gmx  Glycine max (soybean)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100807487
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100807487
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100807487
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100807487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 539 aa AA seqDB search
MNKKALSILMRARMKPNDRTNLSLSPIPLTNARSQMQQQQQNSLPNGSPGDGNSAPNDSG
NSDREFKSVRASMHSAISMNKTEVLDDVLNNFSEGYLSLSRENRRKLLLVLAREYDLNRS
QVRELIKQYLGLELPADKAQVSGSEDEGLFSSFYRVERNLRHALQPVYEVLFERLNTHPG
GLRTLSILREDILSILTEENIASLRALDSYLMEKFITWLSPAALELHQITWDDPASLLEK
IVAYEAVHPISNLLDLKRRLGIGRRCFGYLHPAIPGEPLIFIEVALLKDVAQTIQEVLWD
SPPIPEGEATCALFYSISSTQPGLAGINLGKFLIKRVVTQVKREMPHISTFATLSPIPGF
MSWLLSKLASQRLLAEGDNLSQPQAEGSSSTFYENILKPKEEEALMSLPKDIATGENGMD
VMFNLLTSTSYKWIHSPELLSALKSPLMRLCARYLLQEKKRGKALDSVANFHLQNGAMVE
RINWMADRSDKGLSQSGGIMVNYVYRLDHIEEYAHSYFSNAEIHASSALHHWVDVTDTA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagctttgtccattttgatgcgcgccagaatgaagcccaacgatcgtaca
aacctttctctctctcctattcctctaacaaacgcgaggagtcaaatgcagcagcagcag
cagaattccctcccaaacggatcgccaggtgatggaaattcagcgcctaatgactccggc
aactccgacagagagtttaagagtgtccgcgcctcaatgcactctgccatatcaatgaac
aaaacagaagttttagatgatgtgcttaataacttctcggagggttatttaagcctttct
cgtgaaaaccgtcgcaagttgctccttgtccttgctagagagtatgatctcaataggtca
caagtgcgtgaactgataaagcagtaccttggacttgaacttcctgctgacaaagctcaa
gtgagtggctctgaagacgaaggcttgttttcttctttctatcgcgttgagaggaatttg
aggcatgcccttcagccggtttatgaagttctctttgagcgtctaaacactcatcctgga
gggttgaggaccttatccattcttcgagaagatatcctctctattctcacagaggaaaat
attgcatcgctgagagcattggattcatatttaatggaaaaatttattacgtggcttagt
cctgctgccttagagcttcaccagattacatgggatgaccctgcttctttgctggagaaa
attgttgcctatgaagctgtgcaccctattagcaaccttctagatcttaagagaagactg
ggaattggccgtcgttgttttggatatttacatccagctattcctggtgaacccctaatt
ttcattgaagttgcactactgaaggatgttgctcagactatacaggaagttttgtgggat
agtcctcctatacctgaaggtgaggcaacatgtgccttgttctactccatatcatcaact
cagcctggcttagcagggatcaacttgggaaaatttctcatcaaacgggtcgtaacacag
gtgaaaagagagatgccacatatttctacctttgcaaccctaagtcccatcccgggattc
atgtcgtggcttttatccaagttagcatctcaaagactgcttgctgaaggagacaatttg
tcacaaccacaagcagagggatccagttccactttctatgagaatatacttaagcccaag
gaagaagaagcacttatgagtttacccaaggatattgctacaggagaaaatggaatggat
gtgatgttcaacttgcttacttctacatcctataagtggatccattcaccagaacttctg
tcagcattaaaatcccctttgatgcgtttatgtgccaggtaccttctgcaagagaagaaa
agaggaaaagctttggactctgtagcaaattttcacttgcaaaatggagcgatggttgaa
agaataaactggatggcagatcgttcagataaaggtctttctcaaagtggagggatcatg
gtgaactatgtgtataggttggatcacatagaagaatatgcccattcttacttcagcaat
gctgaaatccatgcctcaagtgctctccatcactgggttgatgtaacagatactgcttag

DBGET integrated database retrieval system