KEGG   Glycine max (soybean): 100807923Help
Entry
100807923         CDS       T01710                                 

Definition
histone deacetylase 6-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100807923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 476 aa AA seqDB search
MGMEEESSNNSSIIEGGASLPSTGSDAKKRRVTYFYEPTIGDYYYGQGHPMKPHRIRMAH
NLIVHYSLHRRMEINRPFPASPADIRRFHSDDYVDFLSSVSPETLADSAFSRHLKRFNVG
EDCPVFDGLFPFCQASAGGSLGAAVKLNRADADIAINWAGGLHHAKKSEASGFCYVNDIV
LGILELLKVHRRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHVKDIGVG
SGKNYAVNVPLNDGMDDESFRSLFRTIIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLS
VRGHADCLRFLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYF
GPDYTLYVDPSNMENLNTPKDMEKIRNTLLEQISQLPHAPGVPFQTTPPTLQLPEEAEED
MDRRPKLRKWDGEDYDSDPDEGGKANSKFPNVTAHMRDITDEMEEEKPEVHPSSCC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggaagaggagagtagcaacaacagcagcatcatagaaggtggtgcttcgctg
ccatcaacgggttcagacgccaagaagcgaagagtgacgtacttctacgagcccacgatc
ggcgattactactacggtcaggggcacccaatgaagccgcaccgaatccgcatggcgcac
aacctcatcgtccactactccctccaccgccgcatggagatcaaccgtcccttcccggcc
tcccccgccgacatccgccgcttccactccgacgactacgtcgactttctctcctccgtc
tcccccgagaccctcgccgattccgccttctcccgccacctcaagcgcttcaacgtcggc
gaggactgccccgtcttcgacggcctcttccccttctgccaggcctccgccggcggctcc
ctcggcgccgccgtcaaactcaaccgcgccgacgccgacatcgccatcaattgggccggc
ggcctccaccacgccaagaagtccgaggcctctggattctgctacgtcaacgacattgtc
ctcggtatcctcgaactcctcaaagttcacaggcgcgtgctgtatgttgacattgatgtt
caccatggtgatggtgttgaggaggccttttacaccactgatagagtgatgacagtgtct
ttccataagtttggggactttttccctggcacaggacacgtcaaggacattggggtggga
tcaggaaagaattatgcagtcaatgtcccattaaatgacggaatggatgatgagagtttc
cgtagtctgtttcgaaccatcattcaaaaagtcatggaggtctatcaaccagaggcagtt
gttctacaatgtggagctgattcattgtctggggacaggttgggttgcttcaacttgtct
gtgagaggtcatgcagattgccttcgttttcttagatcgttcaatgttcctttaatggtc
ttgggtgggggtggatatacaattcggaatgttgcccgttgttggtgttatgagacagca
gtggcagtaggagtggagcctgataataagttgccttataatgaatattatgaatatttt
ggcccagattatactctctatgtcgatccaagcaacatggagaacctaaacacacccaag
gatatggaaaaaataaggaacacactactagaacagatttctcaacttccccatgctccc
ggtgtaccttttcagacaacaccacctaccttacaacttccggaagaggcagaagaggac
atggatagaagacctaaacttcgcaaatgggatggtgaagattatgattctgatcctgat
gaaggtggaaaggctaattccaagtttccaaacgtcactgcccatatgagggacattaca
gatgaaatggaagaagagaaaccagaagtgcatccatcatcttgttgttga

DBGET integrated database retrieval system