KEGG   Glycine max (soybean): 100807970Help
Entry
100807970         CDS       T01710                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmx00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 330 aa AA seqDB search
MSTEKEKTSAPSSSSSSSSSSPSVELCKGVNGLEKILLRESRGSSTEVYLYGGHVTSWKN
DHGEELLFLSNKAIFKTPKAIRGGIPLCFPQFGGLGTLDQHGFARNRFWAIDDDPPPFPT
NTLSKAFVDLILKPSEEDTKIWPHSFEFRLRIALGPGGDLMLTSRIRNTNSEGKPFSFTF
AYHTYFSVSDISEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEVDKIYLSTPTKIAI
IDHEKKRTFVVRKDGLPDAVVWNPWDKKAKALADFGDDEYKHMLCVEAAAIEKPITLKPG
EEWKGRLELSAVPSSYCSGQLDPQRVLLGS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaaaaggagaaaacatctgcaccttcttcttcttcttcttcttcttcttct
tcaccttccgtcgagctctgcaagggtgtcaatggcctcgagaagattcttctccgcgaa
tcgcgtggttcctccaccgaggtgtatctgtacggtggccacgtgacttcttggaagaac
gatcacggcgaggaattgctttttctcagtaataaggctatatttaagactccaaaggca
attcgtggtgggattccactatgctttccacaatttggaggccttggcacccttgaccag
catggatttgctagaaatcgattctgggccattgatgatgaccctcctccttttccaaca
aatactctgagcaaagcctttgttgatttgattcttaagccctctgaagaagacacgaag
atttggcctcacagttttgaattccgtcttaggatagctttgggacctggaggagatctg
atgctgacatctcggatcaggaacacaaacagtgagggaaagccattttcgttcaccttt
gcatatcatacgtatttctctgtatcagatataagtgaagttcgggttgagggattggag
accctggattatctcgataacttgcagaacaaggagcgctttactgaacagggggatgct
ttaacttttgaatcagaagttgacaagatatatcttagcactcccacaaagattgcaatt
attgatcatgaaaaaaagagaacatttgttgtgcgtaaagatggccttcctgatgctgtg
gtgtggaatccttgggataagaaagcaaaggccctggctgattttggcgatgatgagtac
aagcatatgctttgtgtagaggccgctgctattgaaaagcctatcactttgaaacctgga
gaagaatggaaaggaaggttagagctttcagctgtgccctctagttattgcagtggacaa
cttgatccccagagagttcttctgggaagctga

DBGET integrated database retrieval system